KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0411Help
Entry
TepRe1_0411       CDS       T01495                                 

Definition
carbon-monoxide dehydrogenase (EC:1.2.99.2)
Orthology
K03519  
carbon-monoxide dehydrogenase medium subunit [EC:1.2.99.2]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_0411
  Energy metabolism
   00680 Methane metabolism
    TepRe1_0411
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TepRe1_0411
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With other, unknown, acceptors
    1.2.99.2  carbon-monoxide dehydrogenase (acceptor)
     TepRe1_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
448574..449446
Genome map
AA seq 290 aa AA seqDB search
MQEFKYFAPSDINQALKILDSVKGDKRILAGGTDLVIAIRERKINPEVVIDLKNTQNLNY
IKQENGYIKIGSMSTFTDVIESELIKRKARVLHESCYSMGSPQIRNWATIGGNIINASPA
TDSVPALMVLDATVKLESVSGIREFKVQDILKGINKTNLNENEILTEISFKIPSENTVTG
FRKLGRRAALSIARISIACLIEVEENTMRCRDARIALGAVAKNPIRATSAEEVLIGKDIS
QKLIDDCVEVISEIAVKNIGNRPSLPFKRQSIKGISRELLNRLYMELWSN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaattcaaatactttgcgccttcagatataaatcaagccttaaaaattcttgac
agtgtaaaaggtgataaaagaatcttagctggaggaactgatctagtcatagctattaga
gaaaggaaaataaaccctgaagtagtaattgatctaaagaatacccaaaatttgaattat
ataaaacaggaaaacggatacatcaagataggttccatgagcacctttaccgatgttatt
gaatcagaactcatcaaaagaaaggcaagagtacttcatgaatcttgttattcaatgggt
tccccccagattagaaactgggctacaattgggggtaacattatcaatgcttcaccggct
acagattctgtaccagcccttatggttcttgatgctacagttaagcttgagagtgtttcg
gggattagagaattcaaggttcaagatattttaaaaggtataaataagaccaatttaaat
gaaaatgagatactgacagaaatatcatttaagataccgtcagaaaacactgtaacaggt
tttagaaaacttggtcggcgtgccgctttatccattgccagaataagcatagcatgtctt
attgaagttgaagaaaacactatgagatgtcgagacgctagaatagccttgggagcagta
gctaaaaatcctataagggcgacttcagccgaagaagtgctaatcggaaaagatatctca
cagaagcttattgatgattgcgttgaagtaatatcagaaatagcggtgaaaaatatagga
aacaggccatcgttacctttcaagcgacagagcataaagggcatttcaagggaattactg
aatcgactttacatggaattatggtcaaactga

DBGET integrated database retrieval system