KEGG   Tepidanaerobacter sp. Re1: TepRe1_0411Help
Entry
TepRe1_0411       CDS       T01495                                 

Definition
carbon-monoxide dehydrogenase (EC:1.2.99.2)
Orthology
K03519  
carbon-monoxide dehydrogenase medium subunit [EC:1.2.99.2]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tep01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:tep00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tep00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
448574..449446
Genome map
AA seq 290 aa AA seqDB search
MQEFKYFAPSDINQALKILDSVKGDKRILAGGTDLVIAIRERKINPEVVIDLKNTQNLNY
IKQENGYIKIGSMSTFTDVIESELIKRKARVLHESCYSMGSPQIRNWATIGGNIINASPA
TDSVPALMVLDATVKLESVSGIREFKVQDILKGINKTNLNENEILTEISFKIPSENTVTG
FRKLGRRAALSIARISIACLIEVEENTMRCRDARIALGAVAKNPIRATSAEEVLIGKDIS
QKLIDDCVEVISEIAVKNIGNRPSLPFKRQSIKGISRELLNRLYMELWSN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaattcaaatactttgcgccttcagatataaatcaagccttaaaaattcttgac
agtgtaaaaggtgataaaagaatcttagctggaggaactgatctagtcatagctattaga
gaaaggaaaataaaccctgaagtagtaattgatctaaagaatacccaaaatttgaattat
ataaaacaggaaaacggatacatcaagataggttccatgagcacctttaccgatgttatt
gaatcagaactcatcaaaagaaaggcaagagtacttcatgaatcttgttattcaatgggt
tccccccagattagaaactgggctacaattgggggtaacattatcaatgcttcaccggct
acagattctgtaccagcccttatggttcttgatgctacagttaagcttgagagtgtttcg
gggattagagaattcaaggttcaagatattttaaaaggtataaataagaccaatttaaat
gaaaatgagatactgacagaaatatcatttaagataccgtcagaaaacactgtaacaggt
tttagaaaacttggtcggcgtgccgctttatccattgccagaataagcatagcatgtctt
attgaagttgaagaaaacactatgagatgtcgagacgctagaatagccttgggagcagta
gctaaaaatcctataagggcgacttcagccgaagaagtgctaatcggaaaagatatctca
cagaagcttattgatgattgcgttgaagtaatatcagaaatagcggtgaaaaatatagga
aacaggccatcgttacctttcaagcgacagagcataaagggcatttcaagggaattactg
aatcgactttacatggaattatggtcaaactga

DBGET integrated database retrieval system