KEGG   Tepidanaerobacter sp. Re1: TepRe1_0436Help
Entry
TepRe1_0436       CDS       T01495                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tep00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tep00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
470982..471965
Genome map
AA seq 327 aa AA seqDB search
MFANISAGAWVYGTCSDRYVSDGYKDKMDFVSRVERLSNIEEVKGIEITYPFDINEENYD
HYKTLLEEKSLTISCIGVELVCDRKWKTGSFCSPHKEVREETIKLVKKAMDFANQIGVEI
VNLWLGQDGFDYLMQTNYVDAWKFLIEGLRECANHNTKVKLGLEYKASEPRLNCFLNSGG
KALAVAQATGCSNVGVTLDIGHALNAKENPAEIASILMAENKLFHLHFNDNYFIADDDMP
VGSVHFLHFVELIYWLKKLGYSGWYSLDLYPYRDDPDEACKTSIHFIRMIEKMVEKKLKD
LDFHEMAETAASKNMCNLFTKMFDMGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaatattagtgcaggcgcatgggtctatggaacatgcagtgaccgatatgta
agtgatggatataaagataagatggactttgtttcccgagttgaacgtttgtcaaatatt
gaggaagttaaaggtattgagattacctatccatttgacataaacgaagaaaactatgat
cattataaaaccttgttggaagagaaaagcttaaccatttcctgtattggtgttgagctt
gtatgtgatagaaagtggaagaccggttccttctgttctccacataaggaagttcgtgag
gagactatcaagcttgtaaaaaaagccatggattttgccaatcaaattggcgtagaaatt
gtaaatttatggcttgggcaggacgggtttgattatttaatgcagacaaattacgtggat
gcgtggaaattcctgatagaaggcctgagggaatgtgccaatcataatacaaaggttaaa
ctgggtttagagtataaagccagtgaaccccgtcttaactgctttttaaattccggcggt
aaagctttagctgttgcccaggcaacaggctgcagcaatgtaggtgtaactttggatatt
gggcatgctctaaatgccaaagaaaacccggcagaaattgcaagcattttaatggccgaa
aacaagctgtttcatctgcactttaatgataactactttatagctgatgatgatatgcct
gtaggcagtgtacacttcttacattttgtggaattaatctattggctgaaaaaactagga
tattcaggttggtattctcttgacctttatccatatagggatgatcctgacgaagcctgt
aaaacatccattcattttattagaatgatcgaaaagatggtggaaaagaaactaaaggat
ttagattttcatgaaatggcagaaactgcagcaagcaaaaatatgtgtaatttatttact
aaaatgtttgatatgggggagtaa

DBGET integrated database retrieval system