KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0445Help
Entry
TepRe1_0445       CDS       T01495                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00300  Lysine biosynthesis
tep01100  Metabolic pathways
tep01120  Microbial metabolism in diverse environments
tep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TepRe1_0445
Enzymes [BR:tep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TepRe1_0445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEE90644
UniProt: F4LUS6
Position
481661..483067
Genome map
AA seq 468 aa AA seqDB search
MLKNQIDIWIENNKSHLIEDIISLINIKSVKEPSYGKYPFGTGCGKVLDKALAMSEKYGF
STKNHQYYCGTAVLEGKTDKEIGIFTHLDVVPEGNGWEYSPYDAVVEKGYIIGRGSGDNK
GPAMAALYAVRCLHELGIELNHSIRIFYGCDEETGMSDVKYYLDHHQAPSFSIVPDCAFS
VCNGEKGILQMELAGKISDSNLKNFYGGTVSNMVPDTACAVLSCDDKEQIINMIAEQKTE
GIFASCEGECLKITAKGVSGHAAFPEGTINAIQKLAAFLNKYSLVEENDSKVLYFIEDAF
HDAYGGGLEIAYSDDISGKLTHVGSVAEMENGELTIKINIRYPITTDQENMIRKIHEVGN
RYGVYVKSSDNNPPSYVSADSEAIQAMNDICNDVLNTDYEPYVMGGGTYARKLPRAVGYG
PGILNDPSPFGTKRGNGHQPDECVKIRDLTNAIKIYVLALIQLDEILP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaatcaaattgatatatggattgaaaacaacaaatctcatttgatagaagat
ataatttcacttattaacattaaaagtgttaaagaaccttcctacgggaaatatcccttt
ggaacaggttgcgggaaggtcttggataaagcacttgccatgagtgagaaatatggattt
tcaacaaaaaatcatcagtattattgcggtacagcggtgcttgaaggaaaaacagataaa
gaaatcggtatttttactcacttagatgttgttccggagggtaatggttgggaatatagt
ccctatgatgcagttgtagaaaaagggtatattatcggacggggttcgggggacaacaaa
gggcctgctatggctgcgctctatgccgtccgatgcttacatgaattgggtattgagctg
aatcactccatcagaatattttacggatgtgacgaagagaccggtatgagtgatgtgaaa
tattatttagaccaccaccaggcaccaagtttttctattgtacctgattgtgccttttca
gtttgcaatggggaaaaaggtattcttcaaatggaactagcaggcaaaatatctgattct
aatttgaaaaatttctatggtggaaccgtatcaaacatggttcctgataccgcctgtgct
gttttgagttgtgatgacaaagaacaaattataaatatgatagcagagcaaaaaactgaa
ggtattttcgcttcctgtgagggcgaatgtctaaagattaccgcaaaaggagtttcaggt
catgcggctttcccggaaggaacgattaatgccattcaaaaacttgctgcatttctcaat
aaatactcactggtggaagaaaatgacagtaaggttctttatttcattgaggatgctttt
cacgatgcttatggcggcgggttagaaattgcctacagtgatgatatatcaggtaagttg
acacatgtcggttctgttgccgagatggaaaatggagaactgactattaaaataaatatt
agatatccgattacaactgatcaagaaaatatgattcgtaaaatacatgaagttggtaat
cgttatggtgtatatgtaaaaagctcagataacaatccaccatcatatgtatcagcagat
agtgaagcaattcaagcaatgaatgacatatgcaatgacgttctaaataccgactatgaa
ccttatgtaatgggcggaggaacctatgcacgaaaattgcctagggcagttggatacggc
cccggaattttaaatgacccaagtccttttgggactaagcgaggcaacggtcatcagccg
gatgaatgtgttaagattagagatttgacaaatgcgattaagatttatgtactggctctg
atacaattagatgaaattttaccatga

DBGET integrated database retrieval system