KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0571Help
Entry
TepRe1_0571       CDS       T01495                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TepRe1_0571
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TepRe1_0571
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TepRe1_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
610874..612367
Genome map
AA seq 497 aa AA seqDB search
MPKYIMALDQGTTSSRAIIFDENGLIKGVTNREFTQIYPKPGWVEHDAMEIWGSQIGVAK
EVLLKCGLSVNDIAAIGITNQRETTVVWDKNTGKPVYNAIVWQCRRTAPICDDLKARGLT
EKIREKTGLVVDAYFSGTKVKWILDNVEGTREKAEKGELLFGNIDTWLIWNLTGGKVHVT
DYSNASRTMLFNIHKLDWDDEILKELNIPRAMLPKVMPSSHIYGYTTTEVFGGEIPIAGD
AGDQQAALFGQACYAPGMAKNTYGTGCFMLMNTGEKAVESKSGLLTTIAWGADGKVEYAL
EGSIFIAGAVIQWLRDELRVLDNAAQSEELATKVEDNNGVYLVPAFVGLGAPYWDMYARG
AILGLTRGAKREHIVRAALESICYQTRDVLEAMQKDSGITLKSLKVDGGAVANNFLMQFQ
SDILGVPVDRPKVIETTALGAAYLAGLAVGYWKDKNDISAKWQIDRTFKPQMDIDTKERL
YKGWKKAVKRSMDWEDK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagtacattatggctttagaccagggaacaaccagttcgagggctatcattttt
gatgaaaatggcttgatcaagggtgttaccaatcgggaatttacacagatttatcccaaa
cccggctgggtcgagcacgatgctatggaaatttggggaagccaaataggtgttgccaaa
gaggtgcttttaaaatgtggcctatcggtgaatgatattgccgccataggcattacaaac
cagagagaaactacggttgtatgggataagaatacgggaaaacctgtctataatgctatt
gtatggcagtgccgcagaaccgctccgatttgtgatgatctgaaagctcgcggccttact
gaaaaaattcgagagaagaccggcttagtcgttgatgcttatttttcaggaactaaagta
aaatggattcttgataatgttgaaggtaccagggaaaaggctgaaaagggtgaattgtta
ttcggcaacattgatacatggcttatatggaacctgacgggcggtaaagtccatgttacc
gactatagcaatgcctccagaacaatgttatttaatatccataaactggattgggatgat
gaaatactcaaagagttgaatataccaagagcaatgcttcctaaagttatgccgtcaagt
cacatttatggatatacaactacggaagtgtttggcggagaaattccaatagccggtgat
gcaggcgatcagcaggctgctttgttcggtcaggcttgctatgctcccggtatggctaag
aacacctatggaacaggttgcttcatgttgatgaataccggtgagaaggctgttgaatcc
aagagtggtcttcttactacaattgcctggggtgcagatggaaaggtcgagtatgcttta
gaaggaagcatctttatagccggtgctgtaatacagtggctgcgcgatgagctcagagtg
cttgataatgctgcacagagcgaagagcttgcaacaaaagtggaagacaacaatggcgta
tatctggtacctgcgtttgttgggcttggagcaccttactgggatatgtatgcacgtggc
gctattcttggacttacccgcggcgcaaaaagagaacatattgtcagagcagctctggag
tctatttgctatcagacccgtgatgtactggaagccatgcagaaagattctggtatcact
ttgaagagtctaaaagttgatggcggagcagttgccaataacttcttgatgcaattccag
tctgacatcttaggtgtgcctgttgacagacctaaggtaattgaaactacggcactaggt
gctgcctatcttgccggccttgcagtgggctactggaaagataaaaatgatatttcggct
aaatggcagatagacagaactttcaaacctcaaatggatattgatacaaaagaacgctta
tataagggttggaagaaagccgtaaaacggtcaatggattgggaagataaataa

DBGET integrated database retrieval system