KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0610Help
Entry
TepRe1_0610       CDS       T01495                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TepRe1_0610
  Amino acid metabolism
   00300 Lysine biosynthesis
    TepRe1_0610
Enzymes [BR:tep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TepRe1_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
657629..659014
Genome map
AA seq 461 aa AA seqDB search
MDIEKFIKSNENDLLEATREILKIKSVKSSPLPGMPFGGGPAMALQYALNLAESFGLKTK
NLENYAGWAEWGEGDELIGILVHLDVVPEGSGWTYPPYGGEIHDGKIYGRGAIDDKGPAM
AALFALKSLKDSGIKLNKRVRVIFGTDEESGCECMKYYLKHDERLTMGFSPDANYPIING
EKGILTFSFTNSFANEEGKSGVKIVSFKGGHRPNMVPDYAEAHLLGDIGEIKSIAENYKD
EIPGDFKIEQHDNEIIVKSYGVSAHASRPQKGKNAAMLLVKFLGKIKLIGTQYKFIEFLN
SMIGLDNTGKAFGIDFEDDISGLLSLNVGIVEFDQNRAIVTVNIRYPIRYSSDQVISQIR
KNTPDYIDIVDIYDNKPHYVPEDNILIQKLKLAYEKITGEKAYCLSIGGGTYARMFDNCV
AFGPNFPGDPDLAHQKDEYIEIDNLLKNLRIYTYVLKELAQ
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatatagagaagttcattaaatccaatgagaatgatttactggaagctacgcgtgag
attttaaaaatcaagagcgttaagagttctcccttaccaggcatgcctttcgggggaggt
cctgccatggctttgcaatatgctttaaatctagctgaaagttttggccttaaaacaaaa
aatctggaaaattatgcaggctgggcagagtggggggagggtgatgagctaattgggatt
ttagtacatcttgatgtagttcctgaaggcagtggctggacttatccgccttatggtggt
gaaattcatgatggtaaaatatacggaagaggtgcgatagatgacaaaggtcctgccatg
gcagcattatttgcactaaaatctttaaaagattcaggaattaagttaaacaagagagtt
cgagttatttttggcactgatgaagagagcggctgtgaatgcatgaaatattatctaaaa
catgatgaaaggttgaccatgggtttttcacccgatgctaattatccaattatcaatggt
gagaaaggaatacttacattttcatttactaattcatttgcgaacgaagaaggaaaaagc
ggtgtgaaaatagtatcatttaaaggtgggcatcgtcccaatatggttcccgattatgca
gaagcacatcttttaggtgatataggggaaattaaaagtatagctgaaaattataaagat
gaaataccgggagattttaagatagagcagcatgataatgaaatcatagtaaagtcatat
ggagtatctgcacatgccagtagaccccaaaagggtaaaaatgcagctatgctgctggta
aagtttcttgggaagataaaactcattggtactcaatataagtttattgaatttttaaat
agcatgattggcttggataatactggaaaagcttttggcattgatttcgaggacgatata
tcaggtcttcttagtctcaatgtaggtattgtggagtttgatcaaaacagagctatcgtt
accgtaaatatacgttatcccatcagatatagcagtgatcaggtcataagccaaattagg
aagaatacccctgattatatagatattgtagatatttatgacaataaaccccattatgtt
ccggaagataatatcttgatacaaaagcttaaattggcttacgaaaaaatcaccggagag
aaagcttattgtttgtctattggaggcggcacttatgcgagaatgtttgataattgcgta
gcttttggccccaattttccgggtgacccggatttggctcatcaaaaagatgagtatatc
gaaatagataatctcttaaagaatttgagaatttatacctatgttttaaaagaattagcc
caatag

DBGET integrated database retrieval system