KEGG   Tepidanaerobacter sp. Re1: TepRe1_0644Help
Entry
TepRe1_0644       CDS       T01495                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tep00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tep00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tep00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
694689..696008
Genome map
AA seq 439 aa AA seqDB search
MATIVKMPKLGTTMAEGAITKWLKKEGDPVRRGEIYAEIQTDKVNIEDEAPASGVIRKIL
VEEGETVPIGQPIAIIADEDEDISGYFCEQKATLQKEDDKVEHMLQQEESLSQESKPAGK
IKASPAAKRAAREHNVDLWEVAPTGPDGRIVEKDVILYIRGNKVTATPVARKIAEEKQID
LKTLKKTAGKRITKQDLFETQKPETEEFTVKYAIPVTGMRKIIAEKMAYSKKIAPHIYLS
LEVDMTKVIELRQKLSIFIQEKYNVKLSYNDILIKAAAVALRQNPIINSSFSEEEIILKE
EINIGLAVALDGGLIVPVIKNADRKGLANIASETSELIQKAKDKKLMPDDYHGGTFTISN
LGMYDIEKFSAIINQPETAILAAGKILKKPVVAEDDEIAIRPMMNLTLSCDHRAIDGAAG
AKFLQNIKQILEEPMNMLL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatagttaaaatgcccaaactcggcactaccatggccgaaggtgcaattaca
aaatggttaaaaaaagaaggtgaccccgtccggagaggagaaatatatgcagaaattcaa
acagataaagtaaatattgaagatgaagcgccggcttcaggagtaattagaaaaatcctt
gttgaagaaggtgaaaccgttcctattggacagcctatagccataatagctgatgaagat
gaagatatatccgggtatttttgtgaacaaaaggcaacattgcaaaaagaagacgacaaa
gtcgaacatatgcttcagcaggaagaatcattatcgcaagaaagcaagccagcaggtaaa
atcaaagcatctcctgcggcaaaaagggctgcaagagaacataatgtagatttatgggaa
gttgccccgacaggcccggacggtaggatagtggaaaaagatgtaatattatatatccgg
ggaaataaagtaacggctactcccgtagctagaaaaatagcagaagagaaacagatagac
ctgaaaactttaaagaaaactgccggcaagcgaataacaaagcaagacctgtttgaaacg
cagaaaccagaaaccgaagaatttactgtaaaatacgccattcccgttacaggaatgaga
aaaataattgccgaaaaaatggcttacagcaaaaagatcgcaccacacatatatctgtct
ttagaagtagatatgacaaaagttatagagcttaggcaaaaactttcgatatttattcag
gaaaagtataatgtaaagctttcatacaatgatatattgataaaagctgcagcagttgct
ttaaggcaaaatccgataataaactcaagcttttcagaagaggagataatcttaaaagag
gagataaatattggtcttgccgtagccttggacggcggcctcattgtacctgtaataaaa
aatgcagatagaaaaggtcttgcaaatatcgcaagcgaaacttcagaacttatccaaaag
gcaaaagataaaaaacttatgccggatgattatcatggaggaacttttaccatatcaaat
ctcggtatgtatgacatagaaaaatttagtgctataattaaccagccggagacggcaata
cttgcggcagggaagatattgaaaaaaccggtggtagcagaagatgatgaaatagccata
aggccaatgatgaacctgactctatcctgtgaccatcgagcaatagatggtgccgcagga
gctaaattcctgcagaacattaagcaaattcttgaagaaccgatgaatatgctgctttaa

DBGET integrated database retrieval system