KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0710Help
Entry
TepRe1_0710       CDS       T01495                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00010  Glycolysis / Gluconeogenesis
tep00030  Pentose phosphate pathway
tep00051  Fructose and mannose metabolism
tep00052  Galactose metabolism
tep00680  Methane metabolism
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01120  Microbial metabolism in diverse environments
tep01130  Biosynthesis of antibiotics
tep01200  Carbon metabolism
tep01230  Biosynthesis of amino acids
tep03018  RNA degradation
Module
tep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_0710
   00030 Pentose phosphate pathway
    TepRe1_0710
   00051 Fructose and mannose metabolism
    TepRe1_0710
   00052 Galactose metabolism
    TepRe1_0710
  Energy metabolism
   00680 Methane metabolism
    TepRe1_0710
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TepRe1_0710
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TepRe1_0710
Protein phosphatases and associated proteins [BR:tep01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TepRe1_0710
Messenger RNA biogenesis [BR:tep03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TepRe1_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEE90897
UniProt: F4LWJ5
Position
771854..772813
Genome map
AA seq 319 aa AA seqDB search
MNRIGVLTSGGDAPGMNAAVRAIVRKAIHYGIEIYGVHRGFMGLINSDFVKLDISSVGDI
IHRGGTTLLTARCDEFKTEEGQRKALKNLEAFGIEGIIVIGGDGSLRGANALSKLGIPTI
GIPATIDNDIAFTDNCIGFDTAANTVVDALNKVRDTATSHERTFIIEVMGRRAGHLALYT
GLASGAETILVPEIPFDLNAVCDKIEKGYIRGKLHSIIVVAEGAANSMEVGKVIQEKTGL
ETRVIILGHLQRGGNPSAYDRILASRFGGKAVDLIIQNTKDKMLGLINGELVITDIEKVL
SATKPLDMELYQLSDVLSF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattggagtacttacaagcggcggagatgcacccggcatgaatgctgcagtc
agagcgatagttaggaaagctatacattatggcattgaaatctatggtgtacatagaggc
tttatgggactaataaactcggactttgtaaaattggatataagttcggtaggtgatatt
atacatcgcggaggaaccactctacttactgccagatgtgatgagtttaagactgaagaa
gggcaaaggaaagcattaaaaaatcttgaagcttttggtattgagggaatcattgtaata
ggaggagatggctctcttagaggcgccaatgctttgtcaaaacttggtatccctacaatc
gggattcctgcaacgattgacaatgacatagcatttacagataattgtattggttttgat
actgctgcaaatacagtggttgatgcactaaacaaggttagagacactgcaacatcacat
gagcgaacttttattatagaagttatgggcagaagagcaggtcatctggctttatacacc
ggccttgccagcggggctgaaactattttggtaccggaaattccattcgatttaaatgcc
gtatgtgataaaattgaaaaaggctatatcagaggcaaactgcacagtattatcgtagtt
gccgaaggggcggccaacagcatggaagtaggaaaagttatccaggaaaaaaccggtctt
gaaacaagagttatcattttaggtcatttgcaaagaggtggcaatccttcggcatatgat
cgaatattggccagccgttttggaggaaaagctgttgatttaataatacaaaacacaaag
gataaaatgctaggtcttatcaatggggaactggttatcactgatatagaaaaagtgctt
agtgctactaaacccttggatatggaattatatcaattgtcagatgtattatcattttaa

DBGET integrated database retrieval system