KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0710Help
Entry
TepRe1_0710       CDS       T01495                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_0710
   01230 Biosynthesis of amino acids
    TepRe1_0710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_0710
   00030 Pentose phosphate pathway
    TepRe1_0710
   00051 Fructose and mannose metabolism
    TepRe1_0710
   00052 Galactose metabolism
    TepRe1_0710
  Energy metabolism
   00680 Methane metabolism
    TepRe1_0710
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TepRe1_0710
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TepRe1_0710
Protein phosphatases and associated proteins [BR:tep01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TepRe1_0710
Messenger RNA biogenesis [BR:tep03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TepRe1_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
771854..772813
Genome map
AA seq 319 aa AA seqDB search
MNRIGVLTSGGDAPGMNAAVRAIVRKAIHYGIEIYGVHRGFMGLINSDFVKLDISSVGDI
IHRGGTTLLTARCDEFKTEEGQRKALKNLEAFGIEGIIVIGGDGSLRGANALSKLGIPTI
GIPATIDNDIAFTDNCIGFDTAANTVVDALNKVRDTATSHERTFIIEVMGRRAGHLALYT
GLASGAETILVPEIPFDLNAVCDKIEKGYIRGKLHSIIVVAEGAANSMEVGKVIQEKTGL
ETRVIILGHLQRGGNPSAYDRILASRFGGKAVDLIIQNTKDKMLGLINGELVITDIEKVL
SATKPLDMELYQLSDVLSF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattggagtacttacaagcggcggagatgcacccggcatgaatgctgcagtc
agagcgatagttaggaaagctatacattatggcattgaaatctatggtgtacatagaggc
tttatgggactaataaactcggactttgtaaaattggatataagttcggtaggtgatatt
atacatcgcggaggaaccactctacttactgccagatgtgatgagtttaagactgaagaa
gggcaaaggaaagcattaaaaaatcttgaagcttttggtattgagggaatcattgtaata
ggaggagatggctctcttagaggcgccaatgctttgtcaaaacttggtatccctacaatc
gggattcctgcaacgattgacaatgacatagcatttacagataattgtattggttttgat
actgctgcaaatacagtggttgatgcactaaacaaggttagagacactgcaacatcacat
gagcgaacttttattatagaagttatgggcagaagagcaggtcatctggctttatacacc
ggccttgccagcggggctgaaactattttggtaccggaaattccattcgatttaaatgcc
gtatgtgataaaattgaaaaaggctatatcagaggcaaactgcacagtattatcgtagtt
gccgaaggggcggccaacagcatggaagtaggaaaagttatccaggaaaaaaccggtctt
gaaacaagagttatcattttaggtcatttgcaaagaggtggcaatccttcggcatatgat
cgaatattggccagccgttttggaggaaaagctgttgatttaataatacaaaacacaaag
gataaaatgctaggtcttatcaatggggaactggttatcactgatatagaaaaagtgctt
agtgctactaaacccttggatatggaattatatcaattgtcagatgtattatcattttaa

DBGET integrated database retrieval system