KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0743Help
Entry
TepRe1_0743       CDS       T01495                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_0743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_0743
   00052 Galactose metabolism
    TepRe1_0743
   00500 Starch and sucrose metabolism
    TepRe1_0743
   00520 Amino sugar and nucleotide sugar metabolism
    TepRe1_0743
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TepRe1_0743
   00524 Butirosin and neomycin biosynthesis
    TepRe1_0743
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TepRe1_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806377..807333
Genome map
AA seq 318 aa AA seqDB search
MYFIGVDLGGTNIASALVNEKGEIINSTVIPTEAQKGPEYVIGNMKREIHKLINNAAGSK
IVGIGLGIPGLVDIDKGMSLFAGNLGWQNIPVLEQFQNEFDVPVCMDNDVRTAALGEKHF
GAGVGIDNLICITLGTGIGSGIILDGKIYRGHSLSAGEIGHITIVKDGLYCNCGNRGCLE
MYASAPGIVRRTQKYILEGHNTVMTSMIDGDLDKITTKTLSQAWEKGDELAQLVIDETAE
FLGIGLATFAHLINPEVIIIGGGVSLMGDKLFNPLQKYFDEHSMRILRNKLPIIPAKLKS
ESGTVGAAALAMINLGIL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtattttatcggcgtcgatttaggaggtacgaatattgcctcagccttggtaaatgaa
aagggcgaaatcataaacagcactgtcattccaacagaagcacaaaaagggcccgaatac
gtgataggcaatatgaaaagagaaattcacaaactaataaataatgctgcaggttctaaa
attgtcggaataggcctgggaattccgggcctggttgatatagataagggcatgtccctt
tttgccggtaatttaggatggcaaaacatacctgtgctggaacaatttcaaaatgagttt
gatgttcctgtatgtatggataatgacgtaagaacggcagctcttggcgaaaagcatttt
ggtgccggtgtcggaatcgataatttaatctgcataacattaggcaccggcatcggttca
ggaataattcttgacggtaaaatctatagaggtcattctctcagtgccggtgaaatcggc
catattactatagtaaaagatggcctttactgtaattgtggaaatagaggctgtttagaa
atgtatgcttcagctccgggaattgtccgtcgaacacaaaaatacatcctcgaaggccat
aatacggtgatgacttcaatgattgacggagatttagataaaattacaacaaaaacctta
tcacaagcatgggaaaaaggcgatgagcttgctcaactggtaatagacgaaactgcggag
tttttagggattggccttgccacatttgcgcacttgataaatcctgaagtaattattatt
ggcggcggcgtctcgctaatgggagataaactatttaatccactgcaaaaatattttgat
gaacattctatgagaatattgagaaataaactccctattattccggccaaactgaaaagc
gagtcgggtacggtcggagccgcagctttagccatgataaacctgggtattttataa

DBGET integrated database retrieval system