KEGG   Tepidanaerobacter sp. Re1: TepRe1_0743Help
Entry
TepRe1_0743       CDS       T01495                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tep00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tep00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tep00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tep00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tep00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:tep00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806377..807333
Genome map
AA seq 318 aa AA seqDB search
MYFIGVDLGGTNIASALVNEKGEIINSTVIPTEAQKGPEYVIGNMKREIHKLINNAAGSK
IVGIGLGIPGLVDIDKGMSLFAGNLGWQNIPVLEQFQNEFDVPVCMDNDVRTAALGEKHF
GAGVGIDNLICITLGTGIGSGIILDGKIYRGHSLSAGEIGHITIVKDGLYCNCGNRGCLE
MYASAPGIVRRTQKYILEGHNTVMTSMIDGDLDKITTKTLSQAWEKGDELAQLVIDETAE
FLGIGLATFAHLINPEVIIIGGGVSLMGDKLFNPLQKYFDEHSMRILRNKLPIIPAKLKS
ESGTVGAAALAMINLGIL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtattttatcggcgtcgatttaggaggtacgaatattgcctcagccttggtaaatgaa
aagggcgaaatcataaacagcactgtcattccaacagaagcacaaaaagggcccgaatac
gtgataggcaatatgaaaagagaaattcacaaactaataaataatgctgcaggttctaaa
attgtcggaataggcctgggaattccgggcctggttgatatagataagggcatgtccctt
tttgccggtaatttaggatggcaaaacatacctgtgctggaacaatttcaaaatgagttt
gatgttcctgtatgtatggataatgacgtaagaacggcagctcttggcgaaaagcatttt
ggtgccggtgtcggaatcgataatttaatctgcataacattaggcaccggcatcggttca
ggaataattcttgacggtaaaatctatagaggtcattctctcagtgccggtgaaatcggc
catattactatagtaaaagatggcctttactgtaattgtggaaatagaggctgtttagaa
atgtatgcttcagctccgggaattgtccgtcgaacacaaaaatacatcctcgaaggccat
aatacggtgatgacttcaatgattgacggagatttagataaaattacaacaaaaacctta
tcacaagcatgggaaaaaggcgatgagcttgctcaactggtaatagacgaaactgcggag
tttttagggattggccttgccacatttgcgcacttgataaatcctgaagtaattattatt
ggcggcggcgtctcgctaatgggagataaactatttaatccactgcaaaaatattttgat
gaacattctatgagaatattgagaaataaactccctattattccggccaaactgaaaagc
gagtcgggtacggtcggagccgcagctttagccatgataaacctgggtattttataa

DBGET integrated database retrieval system