KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0750Help
Entry
TepRe1_0750       CDS       T01495                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TepRe1_0750
  Lipid metabolism
   00600 Sphingolipid metabolism
    TepRe1_0750
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TepRe1_0750
Enzymes [BR:tep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TepRe1_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
814330..819807
Genome map
AA seq 1825 aa AA seqDB search
MSKKLITSFVLLVFILTNLGIAAFAMPSDGIQEWNDNPTLFQVKREPAHATFIPFADVET
ALMRDRDNSPYFKLLNGQWKFHWSKNPASRPVDFYKEDFDVSQWDEIPVPSCWQLQGYDY
PIYTNVTYPWTGYENPKPPKAPTVYNPVGSYRHTFTIPEDWDGREVFISFQGVESAFYLW
VNGQEVGYSEDSFTPAEFNITEYLEQGENTIAVEVYRWSDGSWLEDQDFIRLSGIFRDVY
LYSVPKVHIRDFKVETDLDDQYKDATLNLRVDLRNLGIENPDNYKVEAMLYDADESPVLL
EPFYTTASFGEEENEVSVELEQFIENPLKWSAEDPNLYTLVLSLKDSTDNILETTSCRVG
FREFEIEDKQMKINGKPIMFKGTNRHEIDPDTGRVISKERMIQDILLMKQFNINAVRTSH
YPNDPMWYDLCDEYGLYLIDEANVESHGANGTLPKSDPNWLDACLDRMKSMVERDKNHPS
VLIWSLGNEAGSGTTFKHMAEWARQADPTRIIHYEGDNQWADVQSNMYARVGTVENYGKT
GTKPYILCEYAHAMGNSVGNLFKYWDVIEKYPNLQGGFIWDWVDQALRWPTPVKRIISDK
SNNKFKSEMFGELEVGRSGNALRGYTILPDVPELNITGQGLTLEAWVKPEASASSDNVII
AKGDSQFAIKHTANYLQQNRSVIEFYIYDADIPGQWTQWVAAAADTPSDWFGEWHHVAGT
YDGTKLTIYIDGELKAEKETTAKITANAYPVGIGRDVERNRGFNGLIDDARIYNRALTID
EINNHERQPDESTVLWVDFEDVEEDGYRDSEFFAYGGDWGDNPNDGNFCANGLIFPDRTV
QPELYEVKKVYQNIGIKAVDLENGQIEIQNKYLFTNLEEFNMSWELLEDDEIIDSGNIVI
DLAPLSSKVITVPFETPQIKPGAEYWLNINFTLKEDTPWADAGHEIAKEQFSMPFSKEPL
SLSISDMPELELEENDEEILINGDKFTIVFDKSKGTMSSYVYDDKEVIKEGPIPNFWRAP
IDNDKGNGMPSRTATWRYAGENRQISNVTVTRLADQVIQIDVDATLPTKVESEYKATYVF
YGSGDVVVNNTLISDSSLPEIPEIGTILTLPEEFENIKWYGRGPQENYWDRNTGALVGVY
NSTVDEEFIPYLEPSETGNKTDVRWVTLTNDEGFGLLAIGMPLIEVNALHYTPEDLSTAS
HPYKLVRRDDITLRLNYKQMGLGGDDSWGAKPHSEFTLYPGKPYSYSYRLKPITLSTQSP
MELNKEVISLDALKGINIDGKPLPSFNSQIPDYEIQILEGSRTIPPVVEPIPTSDKVQLE
VTQAETLPGTATITATSELGVTTIYSIKFITVPEIYLSDIDWINATCGWQTIQRDKSVEG
NPLRLLGPSNQVITFEKGIGTHADSEIIYDIEGKGYGIFESYIGVDREISNGSIIFEVWL
DGEKVFESDVMTARTPAQFISIDVRGKNELKLVAHDAGDGNAEDHADWADAKFKKSDEEP
IAEPKITLTSPNSVQSGIEFTTKIGLSNVTEAVYAADITINYDTNLFELITCQTADDNTV
ISKVYEDELGSVKVSIDFKEPVTAEAIELFDIVFKAKEITETKSGIIGISKALIKTTEVE
ELQVQPIEKTIEVIAEDIPEKVISSIKPVEITTKVGEPPILPDKVIVIYSDNSTAEVNVI
WNEINPEQYANIGKFTVKGTVEGTDIKAVANITVEAISEEKSFTIISGTKLDRTTGIKAK
VKVKHKTESNTHPGNEVVLFQLMKGTTPISIIALEKDIVTEEVFTAHFNVKDYESLAYKV
KVFVFDRFDSDITAPLNLAEPTELD
NT seq 5478 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaacttattactagcttcgttttattggtttttatcttgactaatttaggt
atagctgcctttgcgatgccgtcggatggcatacaagaatggaatgacaatcctacgcta
tttcaggtaaaacgagaaccagctcatgcgacatttataccttttgctgatgttgaaacg
gctctaatgcgagacagagacaactctccctactttaaactacttaacggacagtggaaa
ttccactggtctaaaaatccggcttcaagacctgtggatttttataaagaggattttgat
gtaagccaatgggatgagataccggttcccagctgctggcagctacaaggatatgactac
cctatatatactaatgttacatatccttggacaggttatgaaaatcctaaaccaccgaaa
gcccctacggtatataaccccgttggttcttatcgacacacatttactatacctgaagac
tgggatggacgcgaggtttttatctccttccaaggtgtagaatcagctttttacctctgg
gtaaatggacaagaagtaggctatagcgaagatagctttacacctgcagaatttaatatc
acggagtatttagaacagggtgaaaataccattgctgttgaggtttaccgctggtctgac
ggaagttggctggaagatcaagattttattcgattaagcggtatattccgtgatgtatat
ctttactcagtaccaaaggtgcatatacgcgattttaaagtcgagacagatctagatgat
caatataaagatgcaactttaaacctcagagtagatttaaggaaccttggtattgaaaat
cctgataattataaagttgaagcaatgttgtatgatgcagatgaatctccggttttatta
gaacctttttatacaacggcaagcttcggtgaagaagaaaatgaagtttcagtagaatta
gagcagtttatagagaatccgctaaaatggtcggctgaagacccgaatctttatacactg
gtgttgagtttaaaagattcaacagataatatcctcgaaactaccagttgtagagtgggt
tttagggaatttgaaatagaagataagcagatgaaaatcaatggtaagcctattatgttc
aaaggtacaaaccgacacgaaatagatccggacaccggaagggtcatctcaaaagaaaga
atgattcaagatattctattaatgaagcaatttaatataaatgctgtgcgcacatcacac
tatcctaatgatccaatgtggtatgacctttgcgatgaatatggtctttacctaattgac
gaagcaaatgttgaatctcatggagctaatggtacattacctaaaagtgaccctaactgg
ttagatgcgtgccttgatagaatgaagagtatggtagaacgagataagaaccatccatcg
gtgctaatatggtctttaggtaatgaggccggtagcggaaccacattcaagcatatggcg
gaatgggcacggcaagcagatcctacacgtatcatccattatgaaggggataaccaatgg
gctgatgttcaaagcaatatgtatgctagagtaggtactgttgaaaattacggtaaaacc
ggcactaagccatatatattatgtgaatatgcccatgctatgggtaacagtgtaggcaac
ttattcaaatactgggatgttatagaaaaatacccgaatcttcaaggcggctttatatgg
gattgggtagatcaagcccttagatggcctacgcctgttaagagaataatttctgataaa
agtaacaataaatttaaatccgagatgtttggtgaattagaagtaggtagatctggtaat
gctttgaggggatacacaattttacctgatgtacctgaattaaacattacaggtcaaggc
cttacccttgaagcttgggtaaaaccagaagcttctgcaagcagtgacaatgtaattatt
gcaaagggtgacagtcaatttgcaattaagcatactgcaaattacttgcaacaaaataga
agtgtaattgaattttatatttatgatgcagatattccggggcaatggactcaatgggta
gcggctgctgcagatacaccgtcagactggtttggagagtggcatcatgtggcaggaacc
tatgatggaacaaaattaacgatatatatcgatggtgaattaaaagctgaaaaagaaacc
accgcaaaaatcacggctaacgcataccctgtgggaataggccgggatgttgagaggaat
cgaggttttaatggtttaattgatgatgcccgaatctataaccgtgcacttactattgat
gaaataaataaccatgaaagacaacccgatgaaagtacagtgctgtgggtggattttgaa
gatgtagaggaagatggttatcgtgatagtgaattctttgcctatggcggagattgggga
gacaatccaaatgatggaaacttctgtgcaaatggcttaatattccctgacaggacagtg
cagccggaactttatgaagtaaaaaaagtgtatcaaaatataggaattaaagctgttgat
ttagaaaacggtcagatagaaatacaaaataaatatttgtttacaaatcttgaagaattt
aatatgtcatgggagttattagaagatgatgaaataatcgactcaggcaatatagtaatt
gaccttgcccccctttcttctaaagttattacggtgccttttgagactccacagataaaa
cccggtgcagaatattggctaaatataaactttacattaaaagaagatactccttgggct
gatgcaggtcatgaaattgccaaagaacagtttagtatgccttttagcaaagaaccatta
tccttaagcatatcggatatgcctgagcttgaacttgaggaaaatgatgaggaaatatta
ataaacggagataaatttaccatagtgtttgataaatctaaaggaactatgtcatcttat
gtgtatgatgacaaagaagtcattaaagaaggtccaatacccaacttctggagagcacct
attgataatgataaaggaaacggcatgccgtcaagaactgctacatggcgctatgccgga
gaaaataggcaaataagcaatgtaacggtaacaaggcttgcagatcaagttatacagata
gacgtagatgcaacattgcctacaaaagtagagtcagaatacaaagcaacatatgttttt
tacggcagtggcgatgtggtggttaacaatacattaatatcggattcaagcctccctgaa
atacctgaaataggaacaatactaacattgccggaagaatttgaaaatattaagtggtat
ggacgaggacctcaagaaaattattgggatagaaatacaggtgcacttgtgggagtatat
aatagtactgtggatgaagaatttataccgtatcttgaaccttcagaaaccggaaataag
accgatgttagatgggtaacattgacaaatgatgaaggttttgggctgttggctatagga
atgccgcttattgaagttaacgcactgcattacacacctgaagacttatctactgcaagc
catccctataaactggtacgtcgcgatgatattactttgcggttaaattataagcagatg
ggattaggtggtgacgatagctggggtgcaaaacctcattctgagtttacactttatcct
ggcaaaccatattcttacagctatcgattaaaaccaattactttgtcaacacaatcacct
atggaattgaacaaggaagtaataagcctagatgcattaaaaggtattaacattgatgga
aagccgttaccatcttttaatagccaaataccggattatgaaatacaaattttagaagga
agcagaaccataccacctgtagttgagcctatacccacgagtgataaagtccaattagaa
gtaacccaagcagaaacactgcccggaaccgcgactataacagcaacatcagaattagga
gttacaactatttattcaatcaaatttattactgttccagaaatatatctttccgatatt
gactggataaatgctacttgtggctggcaaaccatccaaagagataaaagcgttgaaggt
aatccattaagattgttagggccatcgaatcaggtaataacattcgaaaaaggtatagga
acacatgccgactcagaaatcatatatgacattgaaggaaagggttatggtatttttgag
tcatatatcggggtagaccgtgaaataagcaatggcagtattatatttgaagtttggtta
gatggtgagaaagtatttgaaagtgatgtaatgactgcaagaaccccagcacaatttata
agtatagatgtaagaggtaaaaatgagctaaaattagtggcccatgacgcgggagatgga
aatgcggaggatcatgctgactgggcagatgccaaatttaaaaaatcagatgaagaacca
attgctgaaccaaaaatcaccctaacaagccctaactcagtccagtcaggcattgaattt
acaacaaaaataggcttaagcaatgtaacagaagcagtctatgcagcagacataacaata
aattacgacactaacctatttgaacttataacatgtcaaacagcagatgacaatactgta
ataagtaaagtctatgaggacgaactaggaagcgttaaggtatccatcgactttaaagaa
ccggtaacagctgaagcaatagaactatttgacatagtttttaaagccaaagaaattacc
gaaactaaatcaggtattataggaatatcaaaagctcttataaaaacaacagaagttgaa
gaactacaagtacagcccatagaaaaaacaatcgaggtaatagcagaagatatcccagaa
aaagtaatatcatcaatcaaacctgtagaaattacaactaaagttggagaacctcctata
cttcctgacaaagttatagtgatatacagcgataattcaacagctgaagtaaatgtaatt
tggaatgaaataaatcctgaacagtatgctaatataggcaagtttacagtaaaaggaact
gttgaagggacagacatcaaagctgtggcaaatataacagtagaagcaatatcagaagaa
aagtcattcaccattatatctggaactaaacttgacagaaccacaggtatcaaagccaag
gtaaaagtaaaacacaagacagaatcaaatacacatccaggtaatgaagtagttctattc
caactgatgaaaggcacaacaccgataagcatcattgcattagagaaagatatagtaact
gaagaagtattcacagctcactttaatgtaaaagactatgaaagcctagcttacaaagta
aaagtattcgtatttgatcgctttgacagtgatataactgctccgttaaatcttgcagaa
ccgactgaactcgactag

DBGET integrated database retrieval system