KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0835Help
Entry
TepRe1_0835       CDS       T01495                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Brite
Enzymes [BR:tep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     TepRe1_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
906804..909842
Genome map
AA seq 1012 aa AA seqDB search
MKLKFKQQKFQIDAVKSVVDCFRGQSNHVSHFQLDTGRVKGEIEGQGSFLDEIGFRNNPI
GLAEDDVLKNIRKVQLRNGLKPSDRLEGRYNLTIEMETGTGKTYTYIRTMYELYRAYSWN
KFIIVVPSIAIREGVYKSFQITEDHFMDLYGTKIRYFIYNSKQLHKIDQFASDSGINAMI
INSQAFNARGKDARRIYEELDDFGTRRPIDVLAQTNPILIIDEPQSVEGKKTKEALKLFK
PLFTLRYSATHKEDYNKIYRLDALDAYNMKLVKKIKVKGITVKGLTGTNSYIYFEGIDVS
TKSKPVARIEFEVKQKNGIKRVARNVDEGFDLYTHSNYMEQYKGYILSEINGYKNTISFT
NGVTLNAGDVQGDISETNLRRIQIREAIKSHFEREKSLYNKGIKVLTLFFIDEVAKYRQY
DESGNQVNGEYGEIFEEEYMNVLNEYITLFDDPYVKYLKSIDVEDTHKGYFSIDSKGRMV
DPSAKGKEKISEDESAYDLIMKDKERLLSFDEPTRFIFSHSALREGWDNPNVFQICTLKH
SDSIIRKRQEVGRGLRLCVDQNGNRIDGETPGIDVHDINVLTVIASESYESFAKSLQSEI
AETLSDRPQKANVEFFLNNVVKNARGEELFIDESLANTLHRSFIRNMYVDDNDILTEKYY
KALEENKINLPEEVNDFKEGIIQLVGKIYSEGVTPLVENSRAENIKELKVNENFKKREFQ
ELWNKINVKTAYYVDFDTKELIKNCIIALDRDLKVSDITYQVKTGEMESISSKEELERGE
AFKVKETAMDKDYSAVTTAIRYDLVGKLVDETKLTRNAIVNILKGIKPMTFYLFRKNPEE
FIIKTARIINEQKAAMIIQHIAYNPIDEVFDTTIFTENTLTGTIGKNAWEVKKHIYDYVV
TDSDVEKRFAEELDSSAEVCVYAKLPRGFFIPTPVGNYSPDWAIVFNEGKVRHIYFITET
KGKLESLKFDTRGIEEVKIHCAGEHFKKISNDTVKYDVVDSYEMLMDKVMGK
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaaatttaaacagcagaagtttcaaatagatgcggtaaaatctgtcgtggat
tgttttagaggacagtcaaatcatgtttcccattttcaactggatacgggcagggtaaag
ggagaaatagaaggtcaaggaagttttttagatgaaatcggtttcaggaacaatcccata
ggattggcagaagatgatgtattaaaaaacatcagaaaagttcaattaagaaatggccta
aaaccctcggacagattagagggcagatataatctgacaattgaaatggaaacaggaacc
ggaaaaacctatacatatattcgaactatgtatgaactgtatcgagcctatagttggaat
aaattcataatagtagtgccttctattgcaattagagaaggagtatataaatcttttcaa
ataactgaagaccattttatggatttatatggtacaaaaatccgatattttatatataat
tccaaacaacttcataaaatagatcaatttgcctctgattccggtatcaatgccatgata
ataaattcccaagcctttaatgcacggggtaaagatgctcgaaggatatatgaggaactg
gatgattttggcaccagaagacccatagacgttcttgcccagaccaatcccatccttata
atagatgagcctcagtccgtagaaggcaagaaaaccaaagaagcgttaaagcttttcaag
ccattatttaccttaagatattcggcaactcacaaggaagattacaataagatatataga
ttagatgctctggatgcttataatatgaaactcgtaaagaaaatcaaggtgaaaggaatt
acagtaaaaggactgactggaaccaatagttacatttattttgaaggaatagatgtaagc
accaagagcaagccggtagccaggatagaattcgaagttaaacaaaaaaatggaattaaa
agagttgccagaaatgtagatgaaggatttgatttatatactcattccaattatatggaa
caatataagggatacatcttatccgagataaacggctataaaaacacaataagctttaca
aacggagttacgcttaatgccggcgatgtccaaggcgacatcagtgaaaccaatttaaga
agaatccagattcgcgaagcgataaagtctcactttgaaagggaaaaatcactctataac
aagggaataaaggtgcttactctcttttttatagatgaggtggcaaaatacaggcaatat
gatgaaagtggaaatcaagtaaatggggaatatggagaaatttttgaagaagaatatatg
aacgtactaaatgaatacataaccctatttgatgatccatatgtaaaatacctaaaatcc
attgatgtggaagatactcataaaggatatttttccatagatagcaaggggagaatggtg
gacccatcagctaaaggcaaagagaagatttccgaggatgagtctgcctatgatttgata
atgaaggataaggaaaggctgctgagctttgatgaaccaaccagatttattttttcccac
tctgccttaagggaaggctgggacaatccgaatgtatttcagatatgcactttaaagcac
agcgattctatcataagaaaaagacaggaagtagggagaggcctcaggctttgtgtagac
caaaatggtaataggatagacggagaaactccgggaatagatgtccatgatataaatgta
cttacagtaatagccagtgaatcttatgaatcatttgcaaaaagcttgcagtcggaaatt
gcagaaaccttatccgacagacctcaaaaggcaaatgtagagtttttcttaaacaatgta
gttaaaaatgccagaggagaagaattatttatagatgaaagcctagcgaataccctgcac
cgctcatttatacgaaatatgtatgtagatgataatgatattttaactgaaaaatactat
aaggctctggaagaaaataagataaatttgccggaggaagtaaatgatttcaaggaaggg
attattcaattagtaggtaaaatatatagtgaaggcgttacacctcttgtagaaaatagc
agagcagaaaatattaaagaactaaaagtcaatgagaattttaagaaaagggaatttcaa
gaactgtggaataagataaatgtaaaaactgcatattatgttgactttgatacgaaggaa
ttgattaaaaactgtattattgcattagacagagatttaaaagtatctgatataacctat
caggtaaagacaggggaaatggaatctatatcctcaaaagaagagctggaaagaggagaa
gcattcaaagtcaaggaaacagctatggataaagattattcagcagtaaccactgctata
agatatgatttggtaggaaaactggtagatgaaaccaaactaacaagaaatgcgatagtt
aacattcttaaaggcattaagccgatgaccttttacttattccggaaaaatcccgaagaa
tttatcataaaaactgcaaggattataaatgaacaaaaggctgccatgataatacagcat
attgcttataatccaatagatgaagtttttgatacaaccatcttcactgaaaacacttta
accggaactataggcaaaaatgcttgggaagtaaaaaaacacatttacgattatgtagtc
actgattccgatgttgaaaaacgatttgccgaagaactggacagcagtgctgaggtatgc
gtatacgccaagcttcccagaggattcttcataccaactccggtagggaactacagtccg
gactgggccattgtattcaatgaaggcaaggtaagacatatatactttatcaccgaaacc
aaagggaagctagaatcattaaaatttgacacaagaggcatagaagaagtcaagattcac
tgtgcgggagaacatttcaaaaaaattagcaacgatacagtaaaatacgatgtggtagac
agctacgaaatgctgatggataaagttatggggaaataa

DBGET integrated database retrieval system