KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1016Help
Entry
TepRe1_1016       CDS       T01495                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TepRe1_1016
  Amino acid metabolism
   00340 Histidine metabolism
    TepRe1_1016
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TepRe1_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1079121..1080386)
Genome map
AA seq 421 aa AA seqDB search
MSIKPIKQSNSQTDFEDNLQVREKVSNILSEIRKKGDIALFNFCQKFDGFEGGNLKISSE
QIQSAYKNLDSEDIQAMKKAAERIEQFAQFQKESILPREVELSPGVTLGHHILPISSSAS
YVPGGRYPLPSSALMSIIPARVAGVKRIVACSPPDRSSGTIHPATLVAMDIAGACEIYCM
GGAHAIGALAFGTESVAPADIIVGPGNQWVTEAKRQVSGNVGIDFIAGPSEVLIIADDAA
NPEFIATDLLAQSEHDPQARGILVSTDEKLIQSVLKYLEGFLGQLPTASVARKAWEDNGE
IFLVDCFEEAAHLSNKIAPEHLELHMSNPDTIIPQLSNYGSLFIGNWAAEVFGDYVSGTN
HILPTMRAARYTGGVWVGTFLKVVSYQKITKEGAQELAPVALKLAELEGLYAHKLAADLR
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaaaccgataaaacagtcaaattctcaaactgattttgaagataatctgcaa
gttagggaaaaggtatcaaacatcctttctgaaatacgaaaaaaaggtgatatagcctta
tttaacttctgtcaaaaatttgacggatttgaaggcggcaatcttaaaatatcatccgaa
cagattcaatccgcctataaaaatctcgactctgaagacattcaagctatgaaaaaagct
gcagaacggattgaacaattcgctcagtttcaaaaggagtcaatattacctcgcgaagtc
gaactatctccgggtgtcactctcggtcatcatattcttcctatttcttcatcagcctct
tatgtgcccggcggaagataccctcttccatcttcggcattgatgtcgattatacctgcc
cgtgtagccggagtaaaaaggattgtagcttgctcgccgcctgatcgttccagtggcact
attcaccctgctacactagtagccatggatatagccggagcttgtgagatatactgcatg
ggtggtgcccatgccatcggagcattggcatttggtacggaaagcgttgctcctgccgat
attatcgtaggccccggaaatcaatgggtaaccgaagcaaaacgccaggtcagcggcaat
gtcgggatagatttcatcgcagggcccagtgaagtactgataatagcagatgatgcggca
aatcccgaattcatagcgactgacctcttggcacagtcagaacatgatccgcaagccaga
ggtatcctggtatccactgatgaaaagcttattcaaagtgttttaaaatacttagaaggt
tttttaggacaacttcctactgcctcagtagcccgcaaggcttgggaagataatggagaa
attttccttgtggattgttttgaggaagctgctcatttatccaacaaaatagcgccggaa
catctggaattacatatgtcgaatcccgataccataattccacaacttagcaattacggg
tctttattcatcggtaattgggctgcagaagtctttggagattatgtttcaggaactaat
catattcttcctactatgagagcagccaggtataccggcggtgtatgggtgggcaccttc
ttaaaggtagtaagctaccagaaaatcacgaaggaaggagcccaagaactggcaccggta
gcattaaaacttgccgagctcgaaggactctacgctcacaaactggcggctgatttaagg
ggttaa

DBGET integrated database retrieval system