KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1078Help
Entry
TepRe1_1078       CDS       T01495                                 

Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TepRe1_1078
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TepRe1_1078
Enzymes [BR:tep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     TepRe1_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1124168..1124854
Genome map
AA seq 228 aa AA seqDB search
MDYWTGIYGERRGGILPKLRLGILVSGGGSNLQSIIDKAEAGYFPAEVVVVISSKQDVYA
LERAKKHNIPTAVVLPKNYKTREEYEDELIKILNSYNVDLVILAGYIRVLSPHFVRAFQG
KIMNIHPSLIPAFCGEGFYGEKVHKAVLDYGVKLTGVTVHFVDEGADTGPIILQRAVPVK
DDDTVETLAARVLEEEHRIYPEAIKLFAEGRLETNGRRVKIISKEDSQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttggattattggacaggtatctatggggaaaggcggggtggtattttgccaaagctgagg
cttgggattttggtatccggcggaggttccaacctgcaatccatcattgacaaagcggaa
gcaggctactttccggcagaagttgttgtagtcatttccagcaagcaagatgtttatgcc
ctggaaagggcaaagaaacacaatattcctacagcggtagtgctgccgaagaattataaa
actagggaagaatatgaagatgagctcataaaaatccttaattcctacaatgtggattta
gtcatacttgcaggatatatcagagtcctatctccacattttgtcagggcttttcaaggt
aaaatcatgaatattcacccatctctcataccggctttttgcggtgaaggattttatggc
gaaaaagtgcataaagccgtgctggattacggcgtgaagctaaccggagtaacagttcat
tttgtggatgaaggggctgacacaggtcccataattctgcaaagagctgtacccgttaag
gatgatgatactgttgaaactttggcagcacgggtgttagaagaggagcacagaatatac
ccggaagcaataaaactatttgccgaaggtagattagaaactaatggccgtagggtcaaa
ataatcagcaaggaggattcgcaatga

DBGET integrated database retrieval system