KEGG   Tepidanaerobacter sp. Re1: TepRe1_1078Help
Entry
TepRe1_1078       CDS       T01495                                 

Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tep00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tep00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1124168..1124854
Genome map
AA seq 228 aa AA seqDB search
MDYWTGIYGERRGGILPKLRLGILVSGGGSNLQSIIDKAEAGYFPAEVVVVISSKQDVYA
LERAKKHNIPTAVVLPKNYKTREEYEDELIKILNSYNVDLVILAGYIRVLSPHFVRAFQG
KIMNIHPSLIPAFCGEGFYGEKVHKAVLDYGVKLTGVTVHFVDEGADTGPIILQRAVPVK
DDDTVETLAARVLEEEHRIYPEAIKLFAEGRLETNGRRVKIISKEDSQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttggattattggacaggtatctatggggaaaggcggggtggtattttgccaaagctgagg
cttgggattttggtatccggcggaggttccaacctgcaatccatcattgacaaagcggaa
gcaggctactttccggcagaagttgttgtagtcatttccagcaagcaagatgtttatgcc
ctggaaagggcaaagaaacacaatattcctacagcggtagtgctgccgaagaattataaa
actagggaagaatatgaagatgagctcataaaaatccttaattcctacaatgtggattta
gtcatacttgcaggatatatcagagtcctatctccacattttgtcagggcttttcaaggt
aaaatcatgaatattcacccatctctcataccggctttttgcggtgaaggattttatggc
gaaaaagtgcataaagccgtgctggattacggcgtgaagctaaccggagtaacagttcat
tttgtggatgaaggggctgacacaggtcccataattctgcaaagagctgtacccgttaag
gatgatgatactgttgaaactttggcagcacgggtgttagaagaggagcacagaatatac
ccggaagcaataaaactatttgccgaaggtagattagaaactaatggccgtagggtcaaa
ataatcagcaaggaggattcgcaatga

DBGET integrated database retrieval system