KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1078Help
Entry
TepRe1_1078       CDS       T01495                                 

Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00230  Purine metabolism
tep00670  One carbon pool by folate
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TepRe1_1078
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TepRe1_1078
Enzymes [BR:tep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     TepRe1_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: AEE91224
UniProt: F4LSF8
Position
1124168..1124854
Genome map
AA seq 228 aa AA seqDB search
MDYWTGIYGERRGGILPKLRLGILVSGGGSNLQSIIDKAEAGYFPAEVVVVISSKQDVYA
LERAKKHNIPTAVVLPKNYKTREEYEDELIKILNSYNVDLVILAGYIRVLSPHFVRAFQG
KIMNIHPSLIPAFCGEGFYGEKVHKAVLDYGVKLTGVTVHFVDEGADTGPIILQRAVPVK
DDDTVETLAARVLEEEHRIYPEAIKLFAEGRLETNGRRVKIISKEDSQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttggattattggacaggtatctatggggaaaggcggggtggtattttgccaaagctgagg
cttgggattttggtatccggcggaggttccaacctgcaatccatcattgacaaagcggaa
gcaggctactttccggcagaagttgttgtagtcatttccagcaagcaagatgtttatgcc
ctggaaagggcaaagaaacacaatattcctacagcggtagtgctgccgaagaattataaa
actagggaagaatatgaagatgagctcataaaaatccttaattcctacaatgtggattta
gtcatacttgcaggatatatcagagtcctatctccacattttgtcagggcttttcaaggt
aaaatcatgaatattcacccatctctcataccggctttttgcggtgaaggattttatggc
gaaaaagtgcataaagccgtgctggattacggcgtgaagctaaccggagtaacagttcat
tttgtggatgaaggggctgacacaggtcccataattctgcaaagagctgtacccgttaag
gatgatgatactgttgaaactttggcagcacgggtgttagaagaggagcacagaatatac
ccggaagcaataaaactatttgccgaaggtagattagaaactaatggccgtagggtcaaa
ataatcagcaaggaggattcgcaatga

DBGET integrated database retrieval system