KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1135Help
Entry
TepRe1_1135       CDS       T01495                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TepRe1_1135
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TepRe1_1135
Enzymes [BR:tep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TepRe1_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1184142..1185590
Genome map
AA seq 482 aa AA seqDB search
MNAQELIQIIPDILSVKGYTDVPIESIDYNSKRIKNGAIFVAIPGFNYDGHDFIPEALER
GAGVVIGEKALDLGGKLYIRVKDSRKALALSSAWFYGYPADKLKLIGVTGTSGKTTVTYL
ISEMLKDIGICTGIIGTIGNVLNNRKLPTSHTTPESLELNQLFSKMVEENIEYLAMEVSS
HSLKLQRVEGIKFDVGVFTNLTQDHLDFHKTFEDYFNSKKKLFSQSKQAVINIDDESGKR
LLSIINIPRYTYGLDKKADLRAENIRMTANGVSYDLVFRNKIYPVFYSTPGLFSVYNSLA
AITAGVALGFPIDDLINTLKKAKGVPGRFELVENNQGIIVIVDYAHKPDGLKNVLLTIRE
FCTGKIITVFGCGGDRDKGKRPIMGKISSELSDYTIITSDNPRSEKPEAIIEQIESGIIG
DNYEKITERAEAIKKAISIAKKGDAVLIAGKGHETYQIFNDKIIHFDDREVAKECLSKGS
FK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcacaagaactaatacagattattccggacatactatcagtaaaaggttatact
gatgtgccgattgagtctattgactataactcaaaaagaataaaaaatggagcaattttt
gtagctattccaggctttaattatgacggacatgattttattcctgaagctcttgagcgt
ggcgccggtgttgtaattggagaaaaagccttagatctgggaggaaaactgtatataaga
gttaaagacagtcgaaaggctctagctttaagctctgcatggttttatggatatcctgct
gataaattgaagttaattggtgttacaggtaccagcggtaagactactgtaacatattta
attagcgagatgttaaaagatatcggtatttgtacaggcataatcggaacaatcgggaat
gtgttaaataatcgaaagttaccaacatcgcatactactcccgaatccttagaattaaac
caacttttttccaaaatggtagaagaaaacattgaatatttggcaatggaagtatcctca
cattccttaaaactgcagcgagtggaaggaataaaattcgatgtgggagtttttactaat
ttgacccaagaccatttggattttcataagacctttgaagattattttaattcaaagaaa
aaactctttagtcaatcaaagcaagctgtgataaatattgatgacgagagcggtaaaaga
ttgttaagcattattaatatccccagatacacctatggtctggataaaaaagctgattta
agggctgaaaatattcggatgacagctaatggagtttcatatgatttggttttcagaaac
aaaatttatcctgtgttctattctaccccgggattatttagtgtctataactccttggca
gctataactgcaggagtggctttaggttttccgatagatgacttaatcaatactctcaaa
aaagcaaagggagttcccggcaggtttgaacttgttgaaaacaatcaaggaattattgta
atagtagactacgcacataaacctgatggcttgaaaaatgttttattaacaattagagaa
ttttgcactgggaaaataattactgtttttggctgcggaggcgacagagataagggtaaa
aggcctattatgggtaaaatatcctcagagctttcagattatacaattataacttcggac
aaccctaggagtgaaaagcccgaagctataattgagcaaatagaaagcggaatcatcgga
gataattatgaaaaaattactgaacgtgcggaggctataaagaaagccatttccatagct
aaaaagggtgatgctgttttgatagccggcaagggacatgaaacttatcaaatatttaat
gataagattatccattttgatgatagagaggtcgcaaaagagtgtttaagcaaggggtca
tttaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system