KEGG   Tepidanaerobacter sp. Re1: TepRe1_1135Help
Entry
TepRe1_1135       CDS       T01495                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1184142..1185590
Genome map
AA seq 482 aa AA seqDB search
MNAQELIQIIPDILSVKGYTDVPIESIDYNSKRIKNGAIFVAIPGFNYDGHDFIPEALER
GAGVVIGEKALDLGGKLYIRVKDSRKALALSSAWFYGYPADKLKLIGVTGTSGKTTVTYL
ISEMLKDIGICTGIIGTIGNVLNNRKLPTSHTTPESLELNQLFSKMVEENIEYLAMEVSS
HSLKLQRVEGIKFDVGVFTNLTQDHLDFHKTFEDYFNSKKKLFSQSKQAVINIDDESGKR
LLSIINIPRYTYGLDKKADLRAENIRMTANGVSYDLVFRNKIYPVFYSTPGLFSVYNSLA
AITAGVALGFPIDDLINTLKKAKGVPGRFELVENNQGIIVIVDYAHKPDGLKNVLLTIRE
FCTGKIITVFGCGGDRDKGKRPIMGKISSELSDYTIITSDNPRSEKPEAIIEQIESGIIG
DNYEKITERAEAIKKAISIAKKGDAVLIAGKGHETYQIFNDKIIHFDDREVAKECLSKGS
FK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcacaagaactaatacagattattccggacatactatcagtaaaaggttatact
gatgtgccgattgagtctattgactataactcaaaaagaataaaaaatggagcaattttt
gtagctattccaggctttaattatgacggacatgattttattcctgaagctcttgagcgt
ggcgccggtgttgtaattggagaaaaagccttagatctgggaggaaaactgtatataaga
gttaaagacagtcgaaaggctctagctttaagctctgcatggttttatggatatcctgct
gataaattgaagttaattggtgttacaggtaccagcggtaagactactgtaacatattta
attagcgagatgttaaaagatatcggtatttgtacaggcataatcggaacaatcgggaat
gtgttaaataatcgaaagttaccaacatcgcatactactcccgaatccttagaattaaac
caacttttttccaaaatggtagaagaaaacattgaatatttggcaatggaagtatcctca
cattccttaaaactgcagcgagtggaaggaataaaattcgatgtgggagtttttactaat
ttgacccaagaccatttggattttcataagacctttgaagattattttaattcaaagaaa
aaactctttagtcaatcaaagcaagctgtgataaatattgatgacgagagcggtaaaaga
ttgttaagcattattaatatccccagatacacctatggtctggataaaaaagctgattta
agggctgaaaatattcggatgacagctaatggagtttcatatgatttggttttcagaaac
aaaatttatcctgtgttctattctaccccgggattatttagtgtctataactccttggca
gctataactgcaggagtggctttaggttttccgatagatgacttaatcaatactctcaaa
aaagcaaagggagttcccggcaggtttgaacttgttgaaaacaatcaaggaattattgta
atagtagactacgcacataaacctgatggcttgaaaaatgttttattaacaattagagaa
ttttgcactgggaaaataattactgtttttggctgcggaggcgacagagataagggtaaa
aggcctattatgggtaaaatatcctcagagctttcagattatacaattataacttcggac
aaccctaggagtgaaaagcccgaagctataattgagcaaatagaaagcggaatcatcgga
gataattatgaaaaaattactgaacgtgcggaggctataaagaaagccatttccatagct
aaaaagggtgatgctgttttgatagccggcaagggacatgaaacttatcaaatatttaat
gataagattatccattttgatgatagagaggtcgcaaaagagtgtttaagcaaggggtca
tttaaatga

DBGET integrated database retrieval system