KEGG   Tepidanaerobacter sp. Re1: TepRe1_1173Help
Entry
TepRe1_1173       CDS       T01495                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TepRe1_1173
Enzymes [BR:tep01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TepRe1_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1226775..1227356
Genome map
AA seq 193 aa AA seqDB search
MLDYLEGVLVHVEPDFAIIDIGGWGLKLNISMFTYNKIKTELGNKLKLYTQMVLRDDAVE
LFGFFDVVERQAYVLLNKVSGIGPKAAISILSLMDVARLKTSILSEDVKDLVKVPGIGKK
TAQKIIIELKDRIKDLPVTSDEGMYNSIIEAREALISLGFNPMEIQLVLDEDSVKNNDSV
EDIIKCALKKLSK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttagattatttagaaggtgtgttggttcatgtcgaacctgactttgccataattgat
ataggtggttggggcttaaagctaaacatttcaatgtttacttacaataaaataaaaact
gagcttggtaataaattaaaactttatacacaaatggtgttaagggatgatgctgtagaa
ctatttggtttttttgacgtagttgaaagacaagcctatgtacttttaaataaggtttct
ggaattggccccaaagcagcaatttccattctctcgttaatggatgttgcacgattaaaa
accagtatattatctgaagatgtcaaagaccttgtaaaggtaccgggtattggcaaaaaa
acggctcaaaaaatcataatcgagttaaaagaccgtataaaagacttacctgtgacctct
gatgaaggcatgtataattctattattgaagcaagagaagcacttatttctttgggcttt
aatcctatggaaatacaattagttttagatgaggattcggtaaaaaacaatgattctgta
gaagacatcataaaatgtgcgctgaaaaaactgtcaaagtaa

DBGET integrated database retrieval system