KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1338Help
Entry
TepRe1_1338       CDS       T01495                                 

Definition
(GenBank) Cellulase
Organism
tep  Tepidanaerobacter acetatoxydans Re1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1383567..1384616)
Genome map
AA seq 349 aa AA seqDB search
MDLSEVLVRLIEPAIPSGSEFQNNELIKEVFSNYCDEVKCDKFGNIISLKRGFSPEYKIM
LAAHMDEIGLMVKHIDDKGFVHFAFIGGVDQRILPAQEVIIHGRKNILGIIGSKPPHIQE
TDERKKAVKAENMFIDTGLTPQDVQRYITIGDFITFKRKPVELLNNCFSSNALDDRAGIA
VMLVALEELSKLKHAVSVYAVATAQEEVGLRGAIVSSYGICPDIGIAIDVCHGNMPDTPE
YNTQKLGLGPALALGPNIHPKLYNRLKQIAEDYKIPYQLDPQPSATGTDAWAIQITKEGI
PTALVSIPLKYMHTTVETLCLDDIKMSGRLLALFIASLCKDFMEGLACY
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttggatttaagcgaagtcttagtacgtcttatagaacctgcaatcccatcaggaagtgaa
tttcaaaacaatgaattaataaaggaggttttttcaaattattgcgatgaagtaaaatgc
gataaatttgggaacataattagtttgaaaagagggttttcgccagaatataaaataatg
cttgctgctcatatggatgaaatcggtttaatggtaaaacacattgatgataaagggttt
gtgcattttgcatttataggaggtgtagaccagcgaatactgccagctcaagaagtaatt
atccatggacgtaaaaatatactaggaattatcggcagtaaaccaccacatatccaagaa
acggatgaacgcaaaaaggcggttaaagctgaaaatatgtttatcgatacaggacttaca
ccacaagatgttcaaagatatatcaccatcggagattttataacttttaagaggaaacca
gttgagctgcttaataattgcttttcatcgaatgctttagatgatagagctggtattgcc
gtaatgttagttgcattagaggaattatctaaactcaagcacgctgtaagtgtatatgca
gtagctacagcacaagaggaggttggcttaagaggtgcaatagtcagtagctatggtatc
tgcccagatatcggaatagctatcgatgtttgccatgggaatatgccagatacacccgaa
tacaatacacagaaactgggattagggccagctttggctctagggcccaatatccatccg
aaactttataatcgattaaagcagatagctgaagactataaaataccttatcagcttgac
cctcagccgtctgcaaccggtaccgatgcctgggctattcaaattaccaaagagggtatc
cctacagctcttgtgtcaatacctctgaaatatatgcatactactgtagaaactctatgc
ttagatgatataaaaatgtcaggtcgccttcttgctctttttatagcatcattatgtaag
gattttatggagggattggcatgttattaa

DBGET integrated database retrieval system