KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1348Help
Entry
TepRe1_1348       CDS       T01495                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TepRe1_1348
Enzymes [BR:tep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TepRe1_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1394652..1395515)
Genome map
AA seq 287 aa AA seqDB search
MEYFDYVRYQDRFLEAKDDYNNAKIIIIGAPMDFTVSFRPGTRFGPKKIREVSYGLESYS
VYTDDSLEDKKFFDAGDADIPFGNVEKSLDILENITEKILEDEKIPLYLGGEHLISYPII
KKVTEKYPDLVVLHFDAHADLRDTYFGEKLSHATVLRRISEHIKDKHIFHFGIRSGVREE
FLYAQQHTHMHPIEVKTPFLNVLQDLKNRPIYITLDIDVVDPAFAPGTGTPEPGGCNSQE
ILEVVSHFKSLNVVGFDLVEVSPANDLSDRTSLLAAKILRELLIGLG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttggaatattttgattatgtgcgataccaagacagatttttggaagctaaagatgattac
aataatgctaaaattataattataggtgcacctatggactttacagtgagcttccgacca
ggtactcgattcggacctaaaaaaatacgcgaggtttcatatggattagaaagttatagt
gtttacactgatgattcacttgaagataaaaagttttttgatgctggagatgcagatatt
ccttttggtaatgtagaaaaaagtcttgatatattagagaatattacagaaaaaattttg
gaagatgaaaaaattcctctttatttagggggagaacaccttataagttatcctataata
aaaaaagttacagagaagtatcctgatcttgtcgtgctccattttgatgcccatgcagat
ttaagagatacttattttggagaaaagttgtcccatgccaccgtcttgcgcaggatatca
gaacatataaaggataaacatatttttcatttcggcataaggtctggagttagggaagag
tttttgtatgcacagcaacacacacatatgcatcctatcgaagtaaaaacgcctttttta
aatgtacttcaagacttaaagaaccggccaatatatataacactagatattgatgttgta
gatccggcttttgctccgggcacaggaactcctgaaccgggcgggtgtaattcgcaggag
atacttgaagttgtatcacattttaagagcttaaacgttgtgggatttgatttggtagaa
gtttctccagctaatgatctatctgatagaacttcacttttagcggctaaaatattacgt
gaattattaattgggctgggataa

DBGET integrated database retrieval system