KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1472Help
Entry
TepRe1_1472       CDS       T01495                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00230  Purine metabolism
tep01100  Metabolic pathways
Module
tep_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TepRe1_1472
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TepRe1_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase Cytidylate_kin ADK AAA_17 MMR_HSR1 dNK ABC_tran RNA_helicase RuvB_N AAA_22 T2SSE AAA AAA_16
Motif
Other DBs
NCBI-ProteinID: AEE91618
UniProt: F4LVN2
Position
complement(1509011..1509628)
Genome map
AA seq 205 aa AA seqDB search
MREQGMLIVVSGPSGVGKGTLCNILVSKVEDVFLSTSATTRLPRPGELDGVNYIFMSHEN
FEDKIKKGQFLEWAKVYTNYYGTPKDVVIKKLSEGKDVILEIDIQGAAQVKKNYPEGIFI
FIAPPSIEELEKRIIKRGSDTKDSVDLRLKCAKEEIQAAFDYDYVIINEDLDTAALMLQS
IVLAERCRVSRNKKKLLEIKGGSQL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagggaacagggtatgttaattgtggtatcaggtccttcaggagttggcaaaggaaca
ttgtgtaatatacttgtaagtaaagttgaagatgtatttctttctacatctgctactaca
aggttacccaggcctggtgagttagacggtgttaattatatttttatgagtcatgaaaac
tttgaagataaaataaaaaaaggacagtttttagaatgggctaaggtatatactaactat
tatggcacaccaaaagatgttgttattaaaaagcttagcgaaggcaaggacgttattctc
gaaattgatatacagggtgcggctcaagttaaaaaaaactatcctgaagggattttcata
tttatagcgcctccaagtattgaagaattagaaaaacgcatcataaaaagaggcagtgat
actaaagattctgttgatttaaggctcaagtgcgcaaaagaggaaattcaggcagccttt
gactatgattatgttataataaacgaagatttggatacagcagctttaatgcttcaatct
atagtcctggccgaaagatgtagggtgtcaagaaataaaaagaaacttttggagatcaag
ggaggaagccaattatga

DBGET integrated database retrieval system