KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1622Help
Entry
TepRe1_1622       CDS       T01495                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TepRe1_1622
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TepRe1_1622
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TepRe1_1622
Enzymes [BR:tep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TepRe1_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1658274..1659458)
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGSHGGQYIPETLMNAVIELEEAYNYYKDDSQFNAELADLFKDYAGRPSLLYFAG
KMTEDLGGAKVYLKREDLNHTGAHKINNVLGQALLAKKMGKTRVIAETGAGQHGVATATA
AALMGMECEIFMGKEDTRRQALNVYKMRLLGAKVHPVTSGTATLKDAVSETMREWTNRIA
DTHYILGSVMGPHPFPTIVRDFQSVISKEIKGQLLEKEGRLPDAVLACVGGGSNAIGAFY
HFINDKSVELIGCEAAGRGVDTFETAATIATGKPGIFHGMKSYFCQDQYGQIAPVYSISA
GLDYPGIGPEHAYLYDSGRAHYVAITDEEAVDAFEYLSRTEGIIPAIESAHAVAYGMKLA
PKMGKDKIIVINISGRGDKDCAAIARYRGENLSE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagggagatttggaagtcatggcgggcagtatataccggaaacattaatgaat
gccgtaattgaactggaagaagcatacaattactataaagatgattcgcaatttaatgct
gaacttgcggatttatttaaagactatgccggaaggccatccctgctttattttgctggg
aagatgacggaggacttaggtggtgcaaaagtctatcttaagcgtgaagacttgaatcat
accggtgcgcataaaataaataatgtgttgggccaggcgcttttagcaaaaaaaatggga
aagactcgtgtgattgctgaaaccggagccggccaacatggagttgcaactgctacagca
gcagcgcttatgggtatggaatgtgaaatttttatgggaaaagaagatactaggcgccaa
gctctaaacgtctacaagatgagacttctcggcgcgaaggtacatccggttacctcaggt
accgctacgttaaaggacgcagtgtcggaaacaatgcgtgaatggacgaaccgcattgcc
gatacacattatatcttaggttcagttatgggtcctcatccatttccaactattgttagg
gatttccaatcagtaatatcaaaagagattaaaggacagttgttggaaaaagaaggccgt
cttccggatgcggttcttgcatgtgtaggcggcggttctaatgcaattggtgcattctat
cattttattaatgacaaatcggtagagctgatcggctgtgaggcagccggcagaggtgtt
gatacttttgaaacggcggcaaccattgccactggaaaaccgggaatctttcatggcatg
aaatcatacttttgtcaagaccaatatgggcaaattgcaccggtttactctatttccgcc
ggtcttgattatcctggaatcgggccggagcatgcttatctatatgattccggcagggca
cattatgtagcaataactgatgaggaggcggttgatgcctttgaatatctttcacgcaca
gaaggcattattccggcgattgagagtgctcatgccgtggcatatggtatgaagctggca
cctaagatgggtaaagacaaaattatagtaattaacatctccgggcggggcgacaaagac
tgtgctgctattgcccgctacagaggggagaatttatcagaatga

DBGET integrated database retrieval system