KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1625Help
Entry
TepRe1_1625       CDS       T01495                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tep01100  Metabolic pathways
tep01110  Biosynthesis of secondary metabolites
tep01130  Biosynthesis of antibiotics
tep01230  Biosynthesis of amino acids
Module
tep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TepRe1_1625
Enzymes [BR:tep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TepRe1_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEE91764
Position
complement(1661812..1662594)
Genome map
AA seq 260 aa AA seqDB search
MILDELAAYAKKRVKRAKETVCLEEMREKAMSLPRGDFYFRHVLESPGMSFICEIKKASP
SKGIISEDFPYRKIVKEYEAAGADCISCLTEPKWFMGSDEIFCQIRSDTYLPMLRKDFTI
DEYQLYEAKCMGADAILLICALLNTSAMANFLDICEEMGICALVEAHDEKEIESAVSAGA
RLIGVNNRNLKDFTVDLNNAARLRDKVPPEAIFVAESGVHSSADIVFLKAIGADAVLIGE
SLMKASDKKSVLESFRRAAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgattttagatgagcttgcagcgtatgccaaaaaacgagtgaagcgagcaaaagaaaca
gtctgtttagaggaaatgcgcgaaaaagcgatgagcttaccaagaggggacttttacttt
cggcatgttttggaaagtccaggtatgtcttttatttgtgaaataaaaaaagcatctcct
agtaaaggaatcatttcggaggattttccttaccgcaagattgtcaaggaatacgaggcg
gcaggtgcggattgtatttcatgtcttacagaacctaaatggtttatgggctcggacgaa
atattttgccagatacgttctgatacttacctccctatgcttcgcaaagactttaccata
gatgagtatcaactatatgaggcaaagtgcatgggtgcagatgcgattcttctaatttgt
gcactgctgaatacgtcagcaatggcgaattttcttgatatatgcgaggaaatgggaatt
tgcgccctggtggaagcacatgatgagaaggaaattgagtcagcggtttcggcaggcgcc
cgtttaattggtgttaataatagaaatctgaaagattttactgtggatttgaataatgct
gcaagactgcgagataaagtaccgcctgaagctatatttgttgcagaatccggtgtacat
tcatctgcagatatagtattccttaaagcaataggtgctgatgcggtactgattggcgag
tctttgatgaaagccagcgataagaagtcagtgcttgagtcttttaggagagcggcacaa
tga

DBGET integrated database retrieval system