KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1706Help
Entry
TepRe1_1706       CDS       T01495                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_1706
   01230 Biosynthesis of amino acids
    TepRe1_1706
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_1706
   00030 Pentose phosphate pathway
    TepRe1_1706
   00051 Fructose and mannose metabolism
    TepRe1_1706
  Energy metabolism
   00680 Methane metabolism
    TepRe1_1706
Enzymes [BR:tep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TepRe1_1706
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TepRe1_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1764774..1765862)
Genome map
AA seq 362 aa AA seqDB search
MGSKITLSVIKADVGGFVGHGSVHPDMLKNAEEILEQQGKELLVDFFVTNVGDDINLILT
HKEGINSEKVHKLAWNTFLSCTEVAKSLKMYGAGQDLLSDAFSGNIKGMGPGIAEMEFEE
RPSEPVIIFMADKTEPGAWNLPLYKIFADPFNTIGLVIDPKMHSGFCFEVLDLVEDKKVT
FSCPEELYDLLIFLGASNRYVVKSVYTKNKEIAAVSSTQKMNQMAGRYVGKDDPVLIVRC
QSGLPAVGEVLEPFANPHLVTGWMRGSHYGPLIPVSQKQAVPTRFDGPPRAIAMGFQLAN
GRLIGPQDLFADVAFDRARQKALKAADYIRQMGPFEPHRLPLDEMEYTTMPQVMEKLKNR
FK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgaaaataactctttcagttattaaagccgatgtgggtggatttgtagggcat
gggagtgttcacccggatatgctaaaaaacgcagaggaaatattagaacagcaagggaaa
gaattattggtagatttttttgttactaatgtgggtgacgatataaatctcatactcaca
cataaagaaggcataaattctgaaaaagttcacaagttagcttggaatacttttcttagc
tgcactgaagtggcaaagagcttaaagatgtatggcgcaggccaggatctcctgtcagat
gcattctccggcaatataaaaggcatgggccccgggatagcagagatggaatttgaagag
cgccccagcgagccggtgataatattcatggcggacaaaaccgagccgggagcttggaat
cttcctttatataagatatttgcagatccgtttaatactattgggcttgtaatagaccct
aaaatgcattcgggtttttgttttgaagtgttagacctcgtagaagataagaaagtaact
ttttcatgcccggaagagctttatgatttattaattttcttaggtgcatcaaacagatat
gttgtaaagagtgtgtatacaaaaaataaggaaatagcagcagtatcttcaacacaaaaa
atgaaccaaatggcaggccgctatgtgggtaaagatgatccggtgcttatagtgcggtgc
cagagtggattgcctgcggtgggggaagtattggagccatttgcaaatcctcatcttgta
acaggctggatgcgaggttcgcactatggaccgttaattcctgtgtctcaaaagcaggca
gttcctacgcgctttgacggaccgcctcgagcaattgccatgggatttcagttggctaac
ggaagattaatagggccacaggacctttttgctgatgtagcctttgacagagctagacaa
aaagctcttaaagcagctgattatataaggcaaatgggtccgttcgaacctcacagatta
cctcttgacgaaatggagtataccacaatgccgcaggtgatggaaaagctgaaaaatcgg
tttaaataa

DBGET integrated database retrieval system