KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_1801Help
Entry
TepRe1_1801       CDS       T01495                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TepRe1_1801
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TepRe1_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1860587..1861528)
Genome map
AA seq 313 aa AA seqDB search
MIKILVIGSFMMDLVAKTPRAPREGETIIGHSFSQFTGGKGANQAVAAAKLGSNVTMLGK
VGEDSFGDSQINSLKSAGVNTEYVIKDNSDSTGVGFVTLEDNGKNRIIIIPGVNMLLKPS
DIIRNEKLIKLSDIIILQLEIPLETVYTAIDIAYKYSKTIIFNPAPAAKINNEYLKKVSY
FIPNEIEAKDFTGIDIVNKESAKIAAAKLLKMGCQNTVITMGDKGVYFLNIKDEEYFVEG
INVNVIDTTAAGDAFVGAFAFGLGQDLDHYDCLRLANASAALSVTRMGAQPSLPYLNEVR
KFMNDRKIKIEKY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattcttgtaataggaagctttatgatggatcttgtggctaaaactccaaga
gctccacgagagggtgaaactataattggtcattccttttctcaatttactggcggaaaa
ggtgcaaatcaagcagtagcagctgcaaaactgggatctaatgttacaatgttaggtaaa
gtaggggaagatagttttggggattcccagataaatagcctaaaatcagccggtgttaat
acagaatatgtgattaaagataattctgattctacaggagtgggatttgttactcttgaa
gacaatgggaaaaacagaattattataataccaggcgtaaatatgctgttaaaaccatcg
gacataataaggaatgaaaagcttattaaattatcagatataattattcttcaactggag
attcctttggaaacagtatatacagctatagatattgcctacaaatacagtaagacaatt
atctttaatccggctccggctgctaaaataaacaatgaatatttaaagaaggtatcatat
tttatacccaatgagatagaagccaaagattttaccggtattgatattgtaaataaagaa
agcgcaaaaatagccgctgcaaaattgttgaaaatgggatgtcagaatacagtaattacc
atgggagacaaaggagtgtactttttaaatataaaagatgaggagtactttgtagaaggc
ataaatgttaatgttatagatacaacggctgcaggagatgcgtttgtcggagcttttgca
tttggccttgggcaggatctggatcattatgactgcctaagactagctaatgcatcagct
gctctatcagtaacaagaatgggtgcccaaccgtcattaccttatttaaatgaagtgaga
aagtttatgaatgacagaaaaatcaagatagaaaaatattag

DBGET integrated database retrieval system