KEGG   Tepidanaerobacter sp. Re1: TepRe1_2142Help
Entry
TepRe1_2142       CDS       T01495                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tep  Tepidanaerobacter sp. Re1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tep00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2235243..2236847)
Genome map
AA seq 534 aa AA seqDB search
MWIENTLIKQYDQTSLKNGSKVIFEMYILSLDVGTSSMRGIIYDERGKLIYSCQEHYKVE
YKPPNIVKQDPLTWKRALYNVLNCISEYVKQQNIDLEAICVTSQRASVIPVDRENQPLYD
AIMWQDKRSYKQCSDINKIISSEELYKKTGLVLDPYFSLPKMIWLKQEKPEIYKKTYKLI
GVQDYIIFLLTNKYVTDWTQASRTMLMNISNFKWDDSIIDQVGLDKSLLPELCPPGSIVG
QMSEEVSKLTNLKTGIPVIISGGDQQCAAIALNVIKPGIVEVNTGTGSFIIMYSDKPIFD
KNNTRTLCSAAAIPGKWIVEAGVLTTGSIYGWVKEQFYKDDENFVQINKEVEQAPVGSDG
VVMLPHFEGSAAPYWNPLATGLIFNLTLGTKRASIARSALEGITLELAENIKLLEQVTEA
EIHTVTIAGGLTKFDVFNEIQADAFNKQVVKFKNSEATSFGAAISAMVTLGIYASYEIAL
QKIQKEKDKITYTPNMENVEKYKKIAWRKNELYKALDDKNIYRTLQNDIQLIHS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
ttgtggattgaaaatacacttattaaacagtatgaccagacaagtttaaaaaatggaagc
aaggtgatctttgaaatgtatattctttcgctagatgtaggcacttcgagtatgagaggg
attatttatgatgaaagaggtaaattgatttattcttgtcaagagcattataaagtagag
tacaaaccaccaaatattgtaaaacaagatcctctaacatggaagagagcattatataat
gtgttaaattgtatctctgaatatgtaaaacaacaaaatatagacttagaggctatatgc
gtaacctctcaaagagcatctgtgataccggttgatcgtgaaaaccaaccgttatatgat
gcaataatgtggcaagataagcgtagttacaaacaatgttcagatattaataaaataatt
agtagcgaggaactatacaaaaaaaccggattagttttagacccatatttttccttgcct
aagatgatatggttgaagcaagaaaaaccggagatatacaaaaaaacatataaacttatc
ggcgtacaagactacattatttttctattaacaaataagtatgtaaccgattggacccaa
gcttccaggacaatgttaatgaatatctcgaattttaagtgggacgatagtatcattgac
caggtaggactagataagtctcttttgccagagctatgtcctcccggcagtattgtaggg
caaatgtctgaggaagtatctaagctgactaatctaaaaacaggaattccagtgataata
tcaggtggagatcaacagtgtgcagctatcgctcttaatgttataaaacctggtattgtg
gaagtaaatacgggtacaggatcgtttatcattatgtattctgataaaccaatttttgat
aaaaacaatactaggacactatgtagtgctgcagcaataccaggaaagtggattgttgaa
gctggagttttgacaacgggctctatttatggctgggtaaaagaacaattctataaagat
gatgaaaattttgtacaaataaataaagaagtagagcaagcgcctgtgggatctgatggt
gtagtaatgcttccgcactttgaaggtagtgcagctccttactggaatccattggcaacg
ggattgatttttaatttaacgctggggacaaaacgcgcaagcatagctagatctgcatta
gaaggtataaccttagaattagcagagaatataaaattactagaacaggtaacagaagca
gaaatacatacagtaacaatagcaggtggtttaacaaaatttgatgtttttaatgaaatc
caggcagatgcatttaataagcaggtagttaaatttaaaaacagtgaagcaacttcgttt
ggagcagcgattagtgctatggtcaccttaggaatctatgcttcatatgaaatagcgctt
caaaaaatacaaaaagaaaaagataagataacctatacccccaatatggaaaatgtagaa
aaatataaaaaaatagcttggagaaaaaatgaattatacaaagcgctggatgataaaaat
atctatagaacccttcaaaatgatattcagctaattcattcgtag

DBGET integrated database retrieval system