KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2200Help
Entry
TepRe1_2200       CDS       T01495                                 

Definition
pyruvate synthase (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_2200
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_2200
   00020 Citrate cycle (TCA cycle)
    TepRe1_2200
   00620 Pyruvate metabolism
    TepRe1_2200
   00640 Propanoate metabolism
    TepRe1_2200
   00650 Butanoate metabolism
    TepRe1_2200
  Energy metabolism
   00680 Methane metabolism
    TepRe1_2200
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TepRe1_2200
Enzymes [BR:tep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TepRe1_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2301988..2302935)
Genome map
AA seq 315 aa AA seqDB search
MATLKELAQVEERFVGGHRLCAGCGHGISVRMVLNALENDENVVVGCATGCLEVASTIYP
YTAWNCSFIHNAFENAAATISGVEAAYRSLKKQGKLKDDFKFVAFGGDGGTYDIGLQSLS
GAMERGHKMVYVCLDNGAYMNTGIQRSSATPIGADTTTSPAGKVIPGKQQPRKDLAALIA
AHNIPYVAQTAISNWQDVHKKAKKAFEVDGPAFINILSPCPRGWRYNTPDIVDLVKKAVE
TRFWPLYEVEDGKWKLNSKPKKYVSVEEFLKPQGRFKHVFAPGNEDLLKRIQEEVDKQWL
ALLERCGEEPELPPR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctacattaaaagaacttgctcaagttgaagaaagatttgtcggaggtcataggctt
tgtgccggatgcgggcatggtatttcagtgcgcatggttttaaatgccctggaaaacgat
gaaaatgtagtagtaggttgtgctacaggctgccttgaagttgcctccacaatatatcca
tatacggcgtggaattgttcctttatacacaacgcatttgaaaatgctgctgctaccatc
agcggtgtagaagctgcatatagatcattaaagaaacagggtaaattgaaggatgacttt
aaatttgtggccttcggtggtgacggagggacttatgatataggcttgcaatcactttcc
ggtgctatggagcgaggccataagatggtatatgtctgtcttgataatggtgcttatatg
aataccggtattcagcgttcaagtgcgacacctataggtgccgatactactacgagccca
gctggaaaggttattcccggaaaacagcagcctcgtaaggacttggcagccttaatagca
gcacataatataccctatgtagctcagacggcaataagcaattggcaggatgtccataaa
aaggcaaagaaggcctttgaagttgacggcccagcttttatcaatattttatcaccttgc
ccgcgaggatggaggtacaacactccggatattgtggacttggttaaaaaggctgtcgaa
acacgtttttggcccctttatgaggtggaagacggtaaatggaaacttaatagtaaacct
aagaaatatgtatctgttgaagaatttttaaaacctcaaggaaggtttaaacatgtattt
gcaccgggtaatgaagatttactgaagcgcattcaagaagaagtggacaaacagtggctt
gctcttcttgaacgttgtggcgaagaacctgaattacccccacgttaa

DBGET integrated database retrieval system