KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2209Help
Entry
TepRe1_2209       CDS       T01495                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_2209
   01230 Biosynthesis of amino acids
    TepRe1_2209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_2209
   00030 Pentose phosphate pathway
    TepRe1_2209
   00051 Fructose and mannose metabolism
    TepRe1_2209
   00052 Galactose metabolism
    TepRe1_2209
  Energy metabolism
   00680 Methane metabolism
    TepRe1_2209
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TepRe1_2209
Protein phosphatases and associated proteins [BR:tep01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TepRe1_2209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2309758..2310939)
Genome map
AA seq 393 aa AA seqDB search
MEKNILFAQSGGPTQVINASCYGIIKEARKYDMKIYAARYGVEGILNENIIEITDIDDGS
LEILRFSPSAAFGSCRHKLKEDEFEKVLDLFLKYNIGYFLYIGGNDSMDTANRFSEYVAK
NGYDIKVIGIPKTIDNDLLNTHFCPGYGSAAKYIATSVREMDFDANVYEKNIITIVEVMG
RDSGFLAAASALARDELVESPHLIYLPEIPFDEEEFLQEVSDVYQERGKVLIAASEGLKD
EQGNYIFLREKKADKFGNIQMGGVGKYLESIVKENIADRVKTIEFSVLQRCAAHILSKTD
NDVAAMVGSAGVRYALEGCNDVMVSIMKNNDSFSTSTTPLKDVALEVKTFPREWIDEKNR
WVTKEAIDYITPLIQGEVKPIFKDGLPKYLRFI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaacatattatttgcacaatcagggggtcccacccaagtcataaatgccagt
tgttatggaataataaaggaagcaagaaaatatgatatgaaaatttatgcggcaagatat
ggtgttgagggaattttaaatgaaaatatcatagaaataacagatatagatgatggttcc
ttagaaattttaagattttcgccctcggctgcctttggatcttgcagacataagcttaaa
gaggatgagtttgaaaaagtattagatttgtttttgaaatataacataggatatttccta
tatatcggtggaaatgattctatggataccgccaatagattttctgaatatgtagctaaa
aacggatatgatattaaagtaatcggcatacctaagacaatagataatgatctcttaaat
acacatttttgtccgggctatggcagtgctgcaaagtatatagcaacatccgtaagagag
atggattttgatgcaaacgtatatgaaaagaatatcataacaattgtagaagtaatgggg
cgagatagcggctttttggctgcggctagtgccttggcaagagatgaattggttgaatcg
ccccatcttatatatcttccggaaataccttttgatgaagaggaatttttgcaagaagtt
agcgatgtctatcaagaaagaggaaaggttttaatagcagcatccgaaggccttaaagat
gagcaaggaaattatatcttccttagagaaaaaaaggcggataagtttggcaatattcaa
atgggcggggttggtaagtatttagagagtatagtgaaggaaaatattgcagacagggta
aagaccatagaattttccgtgctccaaaggtgtgccgcacatattttatcaaaaactgat
aacgatgtagcagcaatggttggcagtgccggagtaagatatgctttggaaggatgtaat
gatgttatggtttctatcatgaaaaacaacgatagtttttcaacttcgacaacgccttta
aaagatgtagcgctggaagtaaagactttccccagggagtggatagatgagaaaaatagg
tgggttaccaaagaggcaattgattatataactccacttattcagggtgaggtaaagccg
atttttaaggatggtttgccgaaatatttaaggtttatttaa

DBGET integrated database retrieval system