KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2217Help
Entry
TepRe1_2217       CDS       T01495                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TepRe1_2217
   01230 Biosynthesis of amino acids
    TepRe1_2217
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TepRe1_2217
   00051 Fructose and mannose metabolism
    TepRe1_2217
   00562 Inositol phosphate metabolism
    TepRe1_2217
Enzymes [BR:tep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TepRe1_2217
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TepRe1_2217
  Exosomal proteins of bladder cancer cells
   TepRe1_2217
  Exosomal proteins of melanoma cells
   TepRe1_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2319546..2320349)
Genome map
AA seq 267 aa AA seqDB search
MNKMGKLYIGTNTKMYMNISQTTDFLTKLHGLTLDISRKNMELFVIPSYTALNSARKSVP
KESISLGAQNMCWEDRGQFTGEISPLMLKEIGVQIVQIGHSERRLIFKETDVEENKKVLC
ALRHNFTPLLCIGETIEQKEKGISDEILKIQIKMGLDKVTPEQAKNIWIAYEPVWAIGVD
GIPASKEYANEKHKVIKDTLIELFGETLGRNIPVLYGGSVNNQNAADLIQMPYIDGLFIG
RSAWDADNFNIIIRNVLPTFLKKLKLN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatggggaaattgtatataggcacaaatacgaaaatgtatatgaacatttct
caaactacagattttttaacaaaacttcatggattaacactagatatttctcgcaaaaac
atggagttatttgttatcccatcatatacggctctaaactctgcaaggaaatcagttccg
aaagagagcatttctttaggcgcacaaaatatgtgttgggaagaccggggtcaatttacc
ggagagatttcgccgctgatgcttaaagaaatcggtgtgcaaattgtgcaaatcggtcat
tcggagaggaggcttatttttaaagaaactgatgtagaagaaaacaaaaaggtattatgt
gcgttaagacataattttacgccacttctctgtattggtgagacaatcgaacaaaaggaa
aagggaatatctgatgaaattttaaagatacaaattaaaatgggtctagataaggttaca
ccagaacaggcaaaaaatatttggattgcatatgagccagtttgggcaataggtgtagac
ggtattccggcatcaaaggaatacgcaaacgaaaagcataaggtgataaaagacacactt
atagagctattcggggaaactttaggcagaaatattccggtgctctatggcggcagtgtc
aacaatcaaaatgccgcagaccttatacagatgccgtatatcgacggattgtttattggt
cgaagtgcatgggatgctgataattttaatataattattcgaaatgtgctgccgacattt
ttaaaaaagcttaagctgaattag

DBGET integrated database retrieval system