KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2256Help
Entry
TepRe1_2256       CDS       T01495                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TepRe1_2256
Enzymes [BR:tep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TepRe1_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2356998..2357465
Genome map
AA seq 155 aa AA seqDB search
MPQVIIAFGSNMGNKEQNIKTALEKMKARGLNIIKVSTIIETEPYGYEDQDTFLNGACIA
DTNLSPQEVLKELLAIEQEMGRVRKIHWGPRNIDLDIIFYENIIVDEDNLKIPHPDAHNR
SFVLGPICEISPSFLHPIYNKPVKELYEELKKQNH
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcaggtgataatagcgtttggaagtaatatgggcaataaagaacaaaacattaaa
acagctttagaaaaaatgaaggcccgcggacttaatataatcaaggtttcaaccataata
gagacagaaccatatggttatgaagaccaagacacttttttaaacggggcatgtattgca
gatacaaatctttctcctcaagaagttttaaaagagctgcttgctattgagcaagagatg
gggagagtgcgaaaaatccactgggggccgagaaatatagatcttgacattatcttctat
gaaaatattatagttgatgaagacaatcttaaaatcccccaccccgatgcccataaccgc
tcttttgtcttaggtcctatatgcgaaatatctccctcttttttgcacccaatatacaac
aaacccgtaaaagaactttatgaagaactgaaaaagcagaatcattaa

DBGET integrated database retrieval system