KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2334Help
Entry
TepRe1_2334       CDS       T01495                                 

Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tep00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TepRe1_2334
DNA repair and recombination proteins [BR:tep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     TepRe1_2334
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TepRe1_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH IMS_HHH HHH_8 HHH_3
Motif
Other DBs
NCBI-ProteinID: AEE92447
UniProt: F4LSQ7
Position
complement(2440452..2441048)
Genome map
AA seq 198 aa AA seqDB search
MAYYAEPLDRLIGELSRLPGIGPKTAQRLAFYILKMSKDRVESLADAILQAKELITYCSI
CGNFTDVDPCSICQTPYRDKNTIMVVEDPKDIVAMEKTRDYKGLYHVLHGAISPLEGIGP
DDIKIKELLARITPEIKEIILATNPNVEGEATAMYLAKLLKPLDVKVTRIAYGIPMGGDL
EYADEVTLTKALEGRQKI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttattatgcagagccgctggatcgcctaatcggcgaactttcccgcctgccgggt
ataggccccaaaacagcccagcgccttgccttctatattctaaaaatgtccaaagaccgt
gtggaaagccttgcagatgctattttgcaagctaaagaattaattacctactgttcgatt
tgcggaaattttactgatgtggacccgtgcagtatatgtcaaacaccctaccgggataaa
aatacaattatggtagtggaggatcctaaagacatagtagctatggaaaagaccagagat
tataaaggtctttaccatgtgctccatggagccatatctcccctggaaggcataggcccc
gacgacatcaagattaaagaactattggcaaggataacaccggaaataaaagaaatcatc
cttgctacaaatcccaatgtggaaggcgaagctaccgccatgtacctggccaagttactc
aaaccccttgacgtaaaggttacccgcatagcttacggaattcccatgggcggagaccta
gaatatgccgacgaagtaacactgacaaaagccctagaaggccgccagaagatttaa

DBGET integrated database retrieval system