KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_2468Help
Entry
TepRe1_2468       CDS       T01495                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Pathway
tep00240  Pyrimidine metabolism
tep00250  Alanine, aspartate and glutamate metabolism
tep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tep00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TepRe1_2468
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TepRe1_2468
Enzymes [BR:tep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TepRe1_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Pantoate_transf
Motif
Other DBs
NCBI-ProteinID: AEE92568
UniProt: F4LTX1
Position
complement(2564459..2565379)
Genome map
AA seq 306 aa AA seqDB search
MLSEKHLLGLEHIKKSDIELILDTADSFKEILDRDVKKVPTLRGKSIVNLFYEPSTRTRT
SFELAGKYLSADTINFTSSASSVQKGETLKDTAKTLEMMGIDAVVIRHSSSGAANYLCNH
VKASVINAGDGTHEHPTQALLDMLTVRERKGTLSGLKVAIFGDILHSRVARSNIFGFTKM
GSDVYVAGPSTLMPVDIEKTGAKLAATVEEAVENADVVIALRIQLERQKKGLFPTVREYC
KFFGLNKEKLDLAKKDALLLHPGPVNRGIELTSEIIDGSQSVINEQVKSGVAVRMAVLYH
LIGGSR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtgaaaaacatcttttaggactggagcatattaaaaaatccgatattgaacta
atcttagatacagcggattcgtttaaagaaattctggacagggatgtaaaaaaagttccc
acactccgcggaaaatcaatagtaaaccttttttatgagccgagcactcgaacccgcaca
tcctttgaattggcaggcaagtatctaagcgctgataccattaattttacatcatccgca
agcagtgtgcaaaagggtgaaaccctaaaagacaccgctaaaaccttggaaatgatgggc
atcgacgcagtagttattagacacagctcatcgggagcggcaaattatctgtgcaaccat
gttaaagcttcggtaataaatgccggtgacggcacccacgaacatcctacacaggcgctg
cttgatatgctgaccgtaagggaaagaaaaggcacattatcagggcttaaagtagctatt
tttggagatattctccacagccgagtagcacgctccaatattttcggatttacaaaaatg
ggttcagatgtatatgtggcaggcccttcaacattgatgcctgttgacatagaaaagacc
ggagcaaaacttgcagcaaccgtagaggaagctgtagaaaatgccgatgttgtaatagca
ctgcgaatacaattggaacggcagaaaaaaggcctgtttccgacggtgagagaatactgc
aaattcttcggcctgaataaagaaaagctggacctggccaagaaagatgcccttttactg
catccgggccctgtaaatcgaggaatcgagcttacatcagagataattgacggcagccag
tcggtcataaacgagcaggtgaaaagcggagttgccgttcgcatggctgttttataccac
ctgataggaggaagccgataa

DBGET integrated database retrieval system