KEGG   Taylorella equigenitalis MCE9: TEQUI_0089Help
Entry
TEQUI_0089        CDS       T01390                                 

Definition
histidine ammonia-lyase (EC:4.3.1.3)
Orthology
K01745  
histidine ammonia-lyase [EC:4.3.1.3]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:teq00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(99945..101486)
Genome map
AA seq 513 aa AA seqDB search
MRKIIINPRQLTFKDLRTVYEGPVQVSLPSSSYEIIVNNREALKNLISNETSVYGINTGF
GLLANTKIADSDLENLQRNLILSHSVGTGDSLPDDIVRLIMVMKVASLAQGASGVRREVV
DSLINLINHNIIPDIPEKGSVGASGDLAPLSHMTLTMIGEGSAYLDGELLPSKEVLERCG
LKPIKLQMKEGLALINGTQVSTALAIRGYFLAQDLLASAVITGSLTVKATRGSSSPFDYR
IHEVRGHHGQSEVAKTYMKLLENSNACTSNPSDVLRVQDPYCLRCQPQVLGACLDIINQA
GHTLITEANAVTDNPLIFDGDEPIAISGGNFHAEPVAFAADILALALCELGSMSERRIAM
LIDKNLSGLPSFLVQNAGLNSGFMIAHVTAAALASENKSIAHPSSVDSIPTSANQEDHVS
MATYGARRLFTMAQNTATIIGIELLGAVQGIDLINKNDLGEDLNSTYKLLRSEVDFYEVD
RLFAPDIEAAKQLILSGKVKNINSELYENWFSN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaataataataaatccaagacaattaacttttaaagatttacgaacagtatac
gaaggtcctgtacaagtatctcttccttcatcaagttatgaaatcatagtaaataatcga
gaggcactaaaaaatcttatatcaaacgaaactagtgtatatggaattaatacgggattt
gggttattagctaatactaaaattgctgattcagatttagaaaatcttcaaagaaactta
attctttcacactctgtgggtactggagattcattaccagatgatattgttagattgatt
atggttatgaaggttgctagtttagctcagggggcatcaggtgtacgaagagaggtcgta
gatagtcttataaatttgattaatcataatattattccagatatccctgaaaaagggtct
gtgggagcatcaggtgacttagctcccttatctcatatgacactaactatgataggggaa
ggtagtgcttatttggatggagagttattgccatcaaaagaagtgcttgaacggtgtggg
cttaagcctattaagttacaaatgaaggaggggctagctttaattaacggtactcaagtt
tctacagcattagctatacgaggatattttttagctcaagatttgcttgcatcggctgtt
attacaggatcccttacagttaaggcaacacgcggatctagctctccttttgattatcga
attcatgaagttagagggcatcatggacagtctgaagttgctaaaacttatatgaagcta
cttgaaaattcaaatgcttgcacttctaatccaagtgatgtattgagagtgcaggatcca
tactgcttacgttgccaaccacaagttttaggtgcgtgtttagatattatcaatcaagct
ggacatacgctcatcacagaagcgaatgctgtcacagataatccattaatatttgatggt
gatgagcctatagccatctctggcggaaactttcatgcggagcctgtggcgtttgcggct
gatattttggcattggctttatgtgagcttgggtccatgagcgaaagacgaattgctatg
ttgattgataaaaatttatctgggcttccatcgtttttagtgcaaaatgcaggtcttaat
tctggtttcatgattgcccatgtaactgcggctgcacttgctagcgagaacaaaagcatt
gcccaccctagtagtgtggacagtattccaacatcagctaatcaagaagatcatgtttcc
atggctacatatggagcacgtaggcttttcactatggctcaaaacacagccaccattatt
ggtattgagttattgggggcagtacagggtatagatttaataaataaaaatgatttagga
gaggatttgaattctacctataaacttcttagaagtgaggtcgacttttatgaagtagat
cgtttatttgctcctgatatagaagcagctaagcaattaattctttctggaaaggtgaaa
aatattaattcagagttgtacgaaaattggttttctaattag

DBGET integrated database retrieval system