KEGG   Taylorella equigenitalis MCE9: TEQUI_0241Help
Entry
TEQUI_0241        CDS       T01390                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:teq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TEQUI_0241
DNA repair and recombination proteins [BR:teq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TEQUI_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261664..262260)
Genome map
AA seq 198 aa AA seqDB search
MTQEPEPLQALIESISGLPGIGVRTARRLAYHMLQNDREGAEYLAHNIKSALITLKHCSK
CNNFSSSDICDICSSNKRDLTTLCIVETPADLIRIEESHGYRGLYYVLMGRITPMSPKGA
QGLNFEHLIERVKESGIKEVIIATNFTTEGETTAHFIKTLFSDLDIQTSRIARGVPSGSE
LEYVDAATIAWALNDRKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaccagagccactccaagcacttattgaatcaatttctggtttaccaggt
attggtgtaagaactgctagaagacttgcctatcatatgcttcaaaatgatagggaaggt
gccgagtatttggcacataacattaaatctgcattgattacacttaagcattgttcaaaa
tgtaataacttttcaagttctgatatatgtgatatctgctcatctaataagcgagattta
acaactttatgcatcgttgagacgccagcagatttaattagaattgaagaaagtcatggg
tatagggggctttattatgtgttgatgggtagaattacacctatgtccccaaaaggagct
caaggtcttaattttgagcacttaattgaaagagtaaaggaatcaggcattaaagaagta
attattgccacaaactttacaacagaaggtgaaacaactgctcatttcataaaaacactt
ttttcagatttggatattcaaacaagtcggattgctcgaggcgtccctagtggtagtgaa
cttgaatacgtagatgcggctactatcgcatgggctttaaatgatagaaagaaatag

DBGET integrated database retrieval system