KEGG   Taylorella equigenitalis MCE9: TEQUI_0279Help
Entry
TEQUI_0279        CDS       T01390                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:teq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296440..297015
Genome map
AA seq 191 aa AA seqDB search
MISRLKGKLIYKFPPTVCIDIGGIAYDVDVSLTSFYELPEVGQEVTLFTHLAVREDAHTL
YGFISEDERATFRTLIKVNGIGFKSALGILSGMSPDALYNAIEEQDSSQLERVPGIGKKT
AARIILELKGKLPEISTLNNTTSNLKNHNDVLIALLNLGYSEKQAKLAISTLPKDIDASE
GVRIALRSMDK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgattagtcgcttaaaaggaaaattaatttataaatttccacctacggtatgtattgat
atcggaggtatcgcatacgatgttgatgtatctctaacttcattttatgagctaccagaa
gttggtcaggaggttactctatttacacatttggcagttagagaggatgcacacactttg
tatggcttcatttccgaggatgagcgtgcgacatttagaacgctgattaaggtaaatggt
ataggatttaaaagtgctttaggcattctttctggtatgtctccagatgcactttataat
gcaatcgaagagcaggattcctctcaactagaacgtgtcccaggtattggaaaaaaaact
gccgctagaattatcttggaactaaaaggtaaacttcccgaaataagcacactaaataac
acaacatcaaatttaaaaaatcataacgatgtcctgattgcccttctaaatttaggatat
tcagaaaaacaagcaaagttagctatcagcaccctaccaaaagatatagatgcttcagag
ggtgttcgcattgcacttagatcaatggataaataa

DBGET integrated database retrieval system