KEGG   Taylorella equigenitalis MCE9: TEQUI_0311Help
Entry
TEQUI_0311        CDS       T01390                                 

Definition
murein precusor biosynthesis protein
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TEQUI_0311
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TEQUI_0311
Enzymes [BR:teq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     TEQUI_0311
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TEQUI_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(326229..328958)
Genome map
AA seq 909 aa AA seqDB search
MYEILNWLKQHVDLDAHLRLDSRDIQKGDVFVACKGHKGDGKEFLTDAIENGASAILIED
NLDIVVLQTPVLVVKNLRQKLGELADAWYGSPSSKIAVIALTGTNGKTSCAHWISKALNS
INIPCATIGTLGTILPSGENLGGSLTTPDVLSVHRILATLVARGIEIVTIEASSIGIEQG
RLDSVQIKIAGFTNLTLDHLDYHKSMQEYEEAKTSLFLRDGLECAIFNLDDMAGVRMYEK
SKASRNLGYSILSNSKAVITASELEFHDYGLSFNIQLPEGKSQVITRLAGRHNIYNLLLV
AGVLSHLNVSVEKIVEIIATIRPVPGRLKLVDIQPFSSSRLINLPHVYVDYSHTPDALAN
AIKALEVVKNIRGGKMACVFGCGGDRDKTKRPVMAKVASECADDIYITSDNPRTENASDI
LNDILKGAKKYSFSHIDRAYTILHAILNASKNDTILIAGKGHEDYQEINGVKHHFDDSHW
AGIGLMLRAGYKINTDSRTLKSDEIFLAIKGENFDGHDFLETIDCIGAIVSKPNPKAKVR
QFIVDDTTLAMGTIAKAWRSQFDIPVIAVCGSNGKTTCKEMIASILKSYAGDGAYFATRG
NLNNHIGVPKSLLSLTDNHRIAVFELGMNHPGEIEYLSGLAKPTIAVVTNAQREHQEFMK
SVEAVARENGSVFQSLDADGVAIYPRSSPYSYIWDEQSRHCKSITFGEAGSVNATNISYD
SEGSSFTVDVESEKLNIHLSILGDHNIQNALAAIATTLSAGIDKKYIESGLAEFKAVKGR
LQKHILKDGTVILDDTYNANPDSVIAAIDILKTLATPRTLVLGDMGEVGVDGVQMHEEIG
TYARENGIDNLLTLGELTKFAQEKFGDNTHFNSHDELAKFLISLHSKSIIIKGSRFMKME
KVLEALTKD
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaattttgaattggcttaagcagcatgtagatttagatgctcacttgagactt
gatagcagagacatccaaaaaggggatgtctttgtcgcttgtaaagggcataaaggagac
gggaaagagtttttaacagatgccatagaaaacggtgcctctgcaatccttattgaagat
aatttagatattgttgttttacaaacgccagtattagtagttaaaaaccttcgtcaaaag
ttaggggagcttgcagatgcctggtatggtagtccgtcaagcaagatagcggttattgct
ctaacaggaactaatggtaaaacatcatgtgctcattggatttcaaaggcgctgaattcc
ataaatataccgtgtgcgactattggaactttgggtacgatattgccttcaggagaaaac
cttgggggtagcctaacaactccagatgttttaagtgtacataggattttagctactctt
gttgcacgtggaattgaaattgtgacgattgaggcctcatctataggtatagagcaagga
cgtttagattcagttcaaattaagatagcgggatttacaaatcttactttagatcatcta
gactatcataaatcgatgcaagaatacgaagaagccaagacttctttgtttttgcgagat
ggtttagagtgtgcaatttttaaccttgatgatatggctggggttcgtatgtacgaaaaa
agtaaagctagtcgtaatcttggttacagtatattatccaactcaaaagctgtcataact
gcatcagaacttgaatttcacgattatggactatctttcaatatacagttgcctgagggt
aagtcgcaagttataactagacttgctggtcgtcacaatatttataatctccttttagta
gcaggtgttctaagtcacttaaatgtaagtgtagaaaaaatagtagaaattatagccaca
ataagacctgttcctggtcgccttaaacttgtagatattcaaccgttttcaagctctaga
cttataaatttacctcatgtatatgttgattattcacatactccagatgcattggcaaat
gcgataaaagctcttgaagtcgtaaaaaatattagaggcggaaagatggcatgtgtattt
ggctgtggaggagatagagacaaaactaaaagacctgtgatggccaaagtagcttctgag
tgtgcagatgatatttatataactagcgataatccaagaactgaaaatgctagtgatatc
ttaaatgacatactgaaaggggcaaaaaaatactcattctcacatattgatagagcatac
acaattcttcatgcaatactaaatgcttcgaaaaatgacaccatacttattgctggcaaa
gggcatgaggattatcaagaaataaacggtgttaagcatcacttcgatgattctcattgg
gctgggattggcttgatgcttagggcgggttataaaatcaatacggatagtagaactcta
aaatctgacgagattttcttggcaataaagggagagaattttgatgggcatgattttcta
gaaactattgattgcataggggcaatagtaagcaaacccaatccaaaagctaaagttaga
caatttatagtagacgataccactttggcaatgggtactattgctaaagcatggcgatct
caattcgatatacctgttattgcagtgtgtggatcgaatggaaaaaccacgtgcaaggaa
atgatagcctctatattaaagtcttatgctggagatggagcctatttcgctactagaggt
aatcttaataatcatattggcgttccaaaaagtcttctaagtcttacagataatcataga
attgcagtatttgaacttggaatgaatcatccaggtgaaatagagtatctctcagggtta
gcaaaacctacaattgcagtagttacaaatgcacagcgtgagcatcaagagtttatgaaa
agtgttgaagcggtagccagggaaaatggcagtgttttccagtctttagatgctgatggt
gtagctatttacccgagaagttcaccgtattcctatatatgggatgagcagtctagacac
tgtaaatctattacatttggagaagctgggtcagttaatgccactaatatctcatatgac
tctgagggatctagtttcactgtcgatgtagagagtgaaaaattaaatattcacttatca
attttaggtgatcataatatccaaaatgcacttgcagctatagccactactttaagtgca
ggtatagataaaaaatatattgaatcaggcttggctgaatttaaagcagtcaagggtcga
ttgcagaaacatatattgaaagacggcaccgtaattctagacgatacatataatgcaaat
cctgactcagttatagcagctattgatatccttaaaaccttagctactccacgtacattg
gtattgggtgatatgggggaagttggtgttgatggtgtgcaaatgcatgaagaaataggg
acctacgcaagggaaaatggtatagataatcttttaacattgggcgagctaactaaattc
gcacaagaaaaatttggcgataacacacactttaatagtcatgatgaacttgctaaattt
ttaatttcactacattcaaaatcaatcatcatcaagggctctagatttatgaaaatggaa
aaagttcttgaggctcttactaaggattaa

DBGET integrated database retrieval system