KEGG   Taylorella equigenitalis MCE9: TEQUI_0343Help
Entry
TEQUI_0343        CDS       T01390                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
teq  Taylorella equigenitalis MCE9
Brite
Enzymes [BR:teq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TEQUI_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(364181..365323)
Genome map
AA seq 380 aa AA seqDB search
MKFASKLLVTCMVAAFASSAIAAERYKPDNELIEPIKAAKVENQAEVDLGAKLYFDPRLS
RSGFISCNSCHNLSMGGTDNLQTSIGDKWQQGPINAPTVLNSTLNFVQFWDGRAKDLKEQ
AGGPIANPGEMAFTHDLAVGLLNSIPQYVEEFKKVYGKEKIDIDQVTKAIATFEDTLVTP
NSRFDQWLSGKEDAITDQELQGYLTFRDAGCVACHNGAAVGGSTFQKMGVVDVYVTDNAS
AGRAGVTGQDIDRMMFKVPTLRNVELTYPYFHDGAANTLKQAVETMGRLQLGKKFTDEEN
ANIVAFLKTLTGDQPDLKLPIIPPSSDATPRPNPWAEMAKAEDKKEDAKPMVAPQGDDRK
ATMPVEKPKMEEKKVEAPKA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcgtctaagcttttagttacctgtatggtcgcagcttttgcttcaagtgca
attgctgccgaaagatacaaaccagataatgaattgattgaaccaattaaagcagctaaa
gttgaaaatcaagcagaagtagatttaggtgcaaaattatatttcgatccacgtctatca
cgttcagggtttatttcctgtaactcttgtcataacctttctatgggcggtactgataac
cttcagacatccatcggcgataagtggcagcaaggacctattaatgctcctacagttctt
aactctactttaaattttgttcagttctgggatggtcgtgcaaaagacttaaaagagcaa
gctggaggtccgattgcaaaccctggggagatggcattcactcacgatttagctgttggt
cttttaaactctattcctcaatatgttgaagagttcaaaaaagtttacggaaaagaaaaa
atagatatcgaccaagttactaaagctatcgctacttttgaagatacattagttactcct
aattctcgctttgaccagtggttatctggtaaagaagatgctatcactgatcaagaactt
caaggatacttgactttcagggatgcaggatgcgtggcttgccataacggggctgcggta
ggcggttctacattccaaaaaatgggtgtagttgacgtatacgtaacagataatgcatct
gctggtcgtgcaggtgttactggtcaagatattgaccgtatgatgtttaaagttcctact
ctacgtaatgttgaattaacttatccgtacttccacgatggtgcagctaacactctaaaa
caagctgtagaaactatgggtcgtttacagttaggtaaaaaattcactgatgaagaaaac
gctaatatagttgctttcttaaaaactttaactggtgaccagcctgaccttaaacttcca
atcattcctccttcaagtgatgctacccctcgtccaaatccatgggcagaaatggcgaaa
gctgaagataaaaaagaggatgctaaacctatggtagctccacagggtgatgatagaaaa
gcaactatgcctgttgaaaagcctaaaatggaagaaaaaaaggtagaagctcctaaagcc
taa

DBGET integrated database retrieval system