KEGG   Taylorella equigenitalis MCE9: TEQUI_0460Help
Entry
TEQUI_0460        CDS       T01390                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:teq00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:teq02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486059..487990)
Genome map
AA seq 643 aa AA seqDB search
MQKKWIKSVLATSVFAGLCMGAVASAKITDLVPVDQKAFDIIKNRMENSAEKTGITILPI
DQAKFLKGQRFDFEVEVADETTKSVEVTFNGKSFKDIFGADLKRIENQTKDGKKYVSFRA
ENVSIASVGDIELVVNAETDSGKKTRKVMWSVVSDASDKKAKNVILFVGDGMSLQAKQLA
RILSKGIYEGRYNNLLAMETLPNVAIVSTSGYDSIVTDSANSASAYNTGHKSVVNAMGVY
ENHTEDTLDDPKVETISEIVKRTRGMAVGIVTTASVTDATPAAVTAHTRRRGDQDYIAAD
FLAEYHRPDVLLGGGIRYFVPKAQAGSKRKDETDVIKDFEAKGFTYVGNRKEMNAAPDDK
PLLGLFASNHMDVYMDREHIPNKEVTKGFDDQPNLVEMTKKALDIVSKNPNGFYLMVEGA
SIDKQIHTMDWQRAVYDAIEMDKAVEYAKNWSKQNGDDTLIVVIADHAHGISITGTYTEA
DGRKGRDAVRTYAEAKYPNFVDEDGDGFPEDPNPEHTLAVQYANFPDHYENYRFQTKPTA
PALAAKDADGKETIKANPARAPEGARLIEGNLPTDKETQEVHSADDIVVMAGGPGSDYFK
GHIENVEVFFGIMRALGIDAVAEKAQASESKATEAKPEQKPAQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaatggatcaaatctgtgcttgcaactagtgtatttgctggtttatgcatg
ggtgcagtagcttctgcaaaaatcactgaccttgtaccagtagatcaaaaagcttttgat
atcatcaaaaaccgtatggaaaacagtgctgaaaaaacaggcattactatcctacctatc
gatcaagcgaaattccttaaaggtcaacgttttgacttcgaagttgaagttgctgacgag
acaactaaatctgttgaagttactttcaacggtaaatcattcaaagatattttcggtgct
gatttaaaacgcattgaaaaccaaactaaagacggtaaaaaatatgtttctttccgtgca
gaaaacgtatcaatcgctagcgttggtgatatcgaattagtagttaatgctgagactgat
tctggcaaaaaaactcgtaaagttatgtggtcagttgttagcgatgcttctgataaaaaa
gctaaaaacgtgatcctatttgttggtgatggtatgagtcttcaagctaaacagcttgct
cgcatcctttcaaaaggtatttatgaaggacgttataacaaccttttagcaatggaaact
cttccaaacgtagcaatcgtttctacttctggttatgattctatcgtgactgactctgct
aactctgcatcagcttacaacactggtcataaatcagtagttaatgctatgggtgtttat
gaaaaccatacagaagacactttggacgatcctaaagttgaaactatttctgaaattgtt
aaacgtactcgtggtatggccgttggtatcgtaactacagcctcagtaactgatgctact
ccagctgctgtaactgctcacactcgtcgtcgcggtgaccaagattatatcgctgcagac
ttcctagctgaatatcaccgtcctgacgtacttcttggtggcggtatccgttacttcgtt
cctaaagctcaagctggttctaaacgtaaagatgaaactgatgttatcaaagacttcgaa
gcaaaaggcttcacatacgttggtaaccgtaaagagatgaatgcagctcctgacgataag
ccacttttaggtctgttcgcttcaaaccatatggacgtttatatggatcgtgaacacatc
cctaataaagaagtaactaaaggatttgacgatcaacctaacttagttgaaatgactaaa
aaagctcttgatatcgtttctaaaaatccaaacggtttctacctaatggttgaaggtgca
tctatcgataaacaaattcacactatggattggcaacgtgcagtatacgatgcaattgaa
atggataaagcagttgaatatgctaaaaactggtctaaacaaaatggtgacgatactcta
atcgttgttattgccgaccatgctcatggtatttcaatcacaggtacttatactgaagct
gacggtagaaaaggtcgtgatgcagtacgtacttacgctgaggctaaataccctaacttt
gtagatgaagacggtgacggcttcccagaagatccaaatccagaacacactttagcagtt
caatatgctaacttccctgatcactacgagaactatcgattccaaactaaacctactgct
ccagctctagctgcaaaagatgctgatggtaaagaaactatcaaagctaatccagctcgt
gctccagaaggtgctcgtttaatcgaaggtaatttacctactgataaagaaactcaagaa
gttcactcagctgacgatatcgttgttatggctggcggtccaggctctgactacttcaaa
ggtcacattgaaaatgttgaagtattcttcggtattatgcgtgctcttggtatagatgct
gttgctgaaaaagctcaagcttcagaatcaaaagcaactgaagctaaacctgaacaaaaa
ccagcacaataa

DBGET integrated database retrieval system