KEGG   Taylorella equigenitalis MCE9: TEQUI_0603Help
Entry
TEQUI_0603        CDS       T01390                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TEQUI_0603
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TEQUI_0603
Enzymes [BR:teq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TEQUI_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(624145..625059)
Genome map
AA seq 304 aa AA seqDB search
MKKKIALVGVPTDVGAGHRGSSMGPEALRVAGISDRLLAMGFEVLDRGNLHGPVNPVRAP
ERGYRNFDEVVEWNRLTCDAIYDELKQGNLPIMLGGDHCLATGSISAVSRYVRESCKKLR
VIWLDAHTDFNTSESTPSGNMHGMPVACLFGHGPKEMVELSGIVPALTSDQIYQIGIRSV
DSIEKVLVHEAGHQVFDMRKLDEIGMREAMEFALDGLTDEYHLHVSFDVDFLDPEIAPGV
GTTVRGGPDYREAQLCMEMIADTGLISSLDIVELNPALDVQNLTANIACELVESLFGKNT
LVRQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatcgcactagttggggtacccacagatgtgggagcaggtcataggggc
tcatctatgggtcctgaggctcttcgtgttgcaggtattagtgatagacttttggcgatg
gggtttgaagttttagatcgcggaaatctgcacggtcctgttaatcctgtacgtgcacct
gaaaggggttacaggaattttgatgaggtggttgagtggaatcgtcttacatgcgatgcg
atatacgatgaactaaagcaagggaatttgcccattatgctcggcggtgatcactgtttg
gctacaggatctataagtgcggtttctcgttatgtacgtgaaagctgtaagaagttgcgt
gtgatatggcttgatgcacacactgatttcaatacatcagaatctaccccaagtggcaat
atgcacggcatgcccgttgcatgcctttttggacatggtcctaaagagatggttgagtta
agtggtattgttcctgcactcacgtcagatcaaatatatcagattggcataagaagcgtt
gactctatcgagaaagtgttggtgcacgaagcgggtcatcaagtgtttgatatgcgtaag
ctagatgaaataggcatgcgtgaagcaatggagtttgcccttgatggtctaaccgatgag
tatcatctgcatgtaagtttcgatgttgattttttagacccagaaattgctcctggagtt
ggtactactgtacgtggtggacctgattaccgcgaagctcagctttgcatggagatgatt
gccgacactggcctaatttcttctcttgatattgtggaacttaatcctgcactagatgtt
cagaatttgactgctaatattgcgtgcgaacttgttgagagtttgtttggcaaaaatact
ttagtcagacagtga

DBGET integrated database retrieval system