KEGG   Taylorella equigenitalis MCE9: TEQUI_0603Help
Entry
TEQUI_0603        CDS       T01390                                 

Definition
(GenBank) Arginase protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00220  Arginine biosynthesis
teq00330  Arginine and proline metabolism
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01130  Biosynthesis of antibiotics
teq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TEQUI_0603
   00330 Arginine and proline metabolism
    TEQUI_0603
Enzymes [BR:teq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TEQUI_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU91545
UniProt: E8UFD1
Position
complement(624145..625059)
Genome map
AA seq 304 aa AA seqDB search
MKKKIALVGVPTDVGAGHRGSSMGPEALRVAGISDRLLAMGFEVLDRGNLHGPVNPVRAP
ERGYRNFDEVVEWNRLTCDAIYDELKQGNLPIMLGGDHCLATGSISAVSRYVRESCKKLR
VIWLDAHTDFNTSESTPSGNMHGMPVACLFGHGPKEMVELSGIVPALTSDQIYQIGIRSV
DSIEKVLVHEAGHQVFDMRKLDEIGMREAMEFALDGLTDEYHLHVSFDVDFLDPEIAPGV
GTTVRGGPDYREAQLCMEMIADTGLISSLDIVELNPALDVQNLTANIACELVESLFGKNT
LVRQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaaatcgcactagttggggtacccacagatgtgggagcaggtcataggggc
tcatctatgggtcctgaggctcttcgtgttgcaggtattagtgatagacttttggcgatg
gggtttgaagttttagatcgcggaaatctgcacggtcctgttaatcctgtacgtgcacct
gaaaggggttacaggaattttgatgaggtggttgagtggaatcgtcttacatgcgatgcg
atatacgatgaactaaagcaagggaatttgcccattatgctcggcggtgatcactgtttg
gctacaggatctataagtgcggtttctcgttatgtacgtgaaagctgtaagaagttgcgt
gtgatatggcttgatgcacacactgatttcaatacatcagaatctaccccaagtggcaat
atgcacggcatgcccgttgcatgcctttttggacatggtcctaaagagatggttgagtta
agtggtattgttcctgcactcacgtcagatcaaatatatcagattggcataagaagcgtt
gactctatcgagaaagtgttggtgcacgaagcgggtcatcaagtgtttgatatgcgtaag
ctagatgaaataggcatgcgtgaagcaatggagtttgcccttgatggtctaaccgatgag
tatcatctgcatgtaagtttcgatgttgattttttagacccagaaattgctcctggagtt
ggtactactgtacgtggtggacctgattaccgcgaagctcagctttgcatggagatgatt
gccgacactggcctaatttcttctcttgatattgtggaacttaatcctgcactagatgtt
cagaatttgactgctaatattgcgtgcgaacttgttgagagtttgtttggcaaaaatact
ttagtcagacagtga

DBGET integrated database retrieval system