KEGG   Taylorella equigenitalis MCE9: TEQUI_0842Help
Entry
TEQUI_0842        CDS       T01390                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
teq  Taylorella equigenitalis MCE9
Brite
Enzymes [BR:teq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TEQUI_0842
Secretion system [BR:teq02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TEQUI_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871779..872627
Genome map
AA seq 282 aa AA seqDB search
MKFELNKLCGGLVLAFTAVTACVVSYVVVSADVVAQTASSVSQTTEKTKVPTTVESKSAG
MKAGALPQDKVDNIKSNIEKTFQVKVLSVNPTPFADLYEVLTDETIIYTNADHNYILAGH
LIDAKSTVDLTDKRVKEQSAKAFASLPVEGAVKRVKGKGTRKLVTFEDPNCPYCKALYKE
LEQMDDVTIYTFLVPLLAKDSVTKVRDIMCSSNPTLSWHEWVTDGKKPQSQANKSCSEPN
PKTFQLARSVNVQGVPVILFPNGERRNGFVRLADIEKIISSK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttgaattaaataaattatgtggtggtctcgtgttggcatttactgctgtgact
gcttgtgtcgtgtcatatgtggttgtgtcggcagatgtggtggctcagactgccagttcc
gtttctcaaactacagaaaagactaaagttcctacaactgttgaatctaaatctgcaggg
atgaaggcgggggcattgccacaagataaagtggacaatattaaatccaatatcgagaag
acttttcaagttaaggttttaagcgtaaatccgactccttttgcggatttgtacgaagta
ttgacggatgagacgataatctatacaaatgcggatcataattatattttggcagggcat
cttatcgacgctaagtcgacagttgatctgacggacaagcgtgttaaagagcagtcagct
aaggcatttgcaagcctgccagtggagggggctgttaagcgcgtgaaaggaaaaggtacg
cgtaaacttgtgacttttgaggacccgaattgcccatattgcaaggctttatataaggag
cttgagcagatggatgatgtcactatttatactttcttagtgcccttattagcaaaggat
tctgtgactaaggtgcgggacattatgtgttcatcgaacccaactctttcatggcacgag
tgggttacagacggcaagaagccacaatctcaggctaataaaagttgttctgagccaaac
cctaaaacatttcagcttgctagaagcgttaatgtgcagggggtgccagtgattttattt
cctaatggagaacgaagaaacggttttgttcgtttagcggatattgaaaaaattatttct
tctaagtaa

DBGET integrated database retrieval system