KEGG   Taylorella equigenitalis MCE9: TEQUI_0865Help
Entry
TEQUI_0865        CDS       T01390                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
teq  Taylorella equigenitalis MCE9
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(890021..890704)
Genome map
AA seq 227 aa AA seqDB search
MSSLNSLLEKSRINMILQQIKPAGVLDERVLNALLGLSREAFVAPEFVTVAYSDTSIPIV
VNGEPSGEHMLTPITEARIAQSLSLLPTDTCLEIGTGSGFQAALLSRLCTEVESVEINPN
IANFAMENLARNHISNVRVQIGDASSGWGTREYNAIAITGSCPKLPDALKYQLSVGGRLV
GFIGTPPVIEMKLITRMSASEFDEVNLTETVIEKLHGSAFVESEFIF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcttaaattcacttctcgagaaaagccgcatcaatatgattctacagcagatt
aaacctgcaggtgttttggatgagcgtgtgcttaacgcacttttaggactttctcgagag
gcatttgtggcacctgaatttgtcacagttgcttattcagacactagcatacctatagta
gtaaacggagagccatctggcgagcacatgcttacaccaattacggaagctagaatcgca
cagtctctttcattacttcctaccgacacttgcttagagattggtactggtagcggattt
caagcagcacttctaagtcgcctatgtacagaagttgagtcagtagagataaatcctaat
attgcaaactttgcgatggagaacctagcacgtaatcatattagtaatgtacgtgtgcag
attggagatgcatcttctggctggggtacacgtgaatataacgcaatcgctattacaggt
tcttgccctaagttacctgatgccttgaagtatcagctttccgttggtggtcgattggtg
ggttttattgggactcctccagtaatcgagatgaagcttatcacccgtatgagtgcctct
gaatttgatgaagtgaacttaaccgaaaccgtaatagaaaaactgcacgggtctgctttc
gtagagtctgaatttattttttaa

DBGET integrated database retrieval system