KEGG   Taylorella equigenitalis MCE9: TEQUI_0941Help
Entry
TEQUI_0941        CDS       T01390                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:teq00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:teq00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965756..966253
Genome map
AA seq 165 aa AA seqDB search
MPKICLIVAYSENHAIGLNGDMPWRLKGDLAYFKKTTMGCPIIMGRKTRDSLGRPLPGRI
NIAISRDADYFADGTVVLPSLEQSLEYANNNSDASKIFIIGGGQIYKQALPVADKVYATE
IHKSFEADTFFPQLDKSQWTEVSRDPQPEENGLAYDFVVYEKKEF
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaatttgtcttatcgttgcatattctgaaaaccatgctattggtcttaacggt
gatatgccgtggaggcttaaaggtgaccttgcctatttcaaaaaaaccacaatggggtgt
cccattatcatgggtcgcaaaacgcgtgactcgctcggtaggccattgccaggcaggata
aatattgcaatttcacgggatgcagactattttgcagatgggacggtagtattgccatcc
ttagaacaatcgttggaatatgcaaataataattctgatgcctcgaaaatttttataata
ggaggtgggcagatttacaaacaggcattgcccgtagcggataaagtatacgcaactgaa
attcataagagtttcgaagcggatacattttttccacaacttgataaatcgcaatggacc
gaagtttcaagagatcctcagcctgaggaaaacggtcttgcgtacgatttcgtggtttac
gaaaagaaggagttttaa

DBGET integrated database retrieval system