KEGG   Taylorella equigenitalis MCE9: TEQUI_0943Help
Entry
TEQUI_0943        CDS       T01390                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00010  Glycolysis / Gluconeogenesis
teq00030  Pentose phosphate pathway
teq00051  Fructose and mannose metabolism
teq00052  Galactose metabolism
teq00230  Purine metabolism
teq00500  Starch and sucrose metabolism
teq00520  Amino sugar and nucleotide sugar metabolism
teq00521  Streptomycin biosynthesis
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01120  Microbial metabolism in diverse environments
teq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_0943
   00030 Pentose phosphate pathway
    TEQUI_0943
   00051 Fructose and mannose metabolism
    TEQUI_0943
   00052 Galactose metabolism
    TEQUI_0943
   00500 Starch and sucrose metabolism
    TEQUI_0943
   00520 Amino sugar and nucleotide sugar metabolism
    TEQUI_0943
  Nucleotide metabolism
   00230 Purine metabolism
    TEQUI_0943
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TEQUI_0943
Enzymes [BR:teq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TEQUI_0943
    5.4.2.8  phosphomannomutase
     TEQUI_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADU91874
UniProt: E8UGB0
Position
complement(967574..968968)
Genome map
AA seq 464 aa AA seqDB search
MEVLPPQNIGSVLIAHDAREGGPELAKALYNALKTRVKSEHIQFAGLEHPGLLAIHNIHK
NYGLIIYITASHNPVGFNGFKIYCDSLPIDSETIKLIAYNMKRLADADFKFLHYSEEIFE
QPPIEEIENSEYINALLSEPDYCHEKYILKIAIDGGNGVAGLIARELYEKMGHEVLELNC
IPDGAFPNHHPDPSVPDNLMQLRKFVVEHGCDIGLAFDGDADRLGVVDYQGQIIGSDRVF
IFLIREMMKFYKSYSDYDPAKPVHIVYDIKSSRHIQREIEAAGALPHLSKTGHSNMMQKV
AQIEGALFGGEYSGHYYFKKDGLILNDAVYSGFRILRFIEEVGPEAFEHLPHDLMVPEIR
IPYPRELVKGLLLHVKDSAQKNLNPISFTEIDGLRIEIEGGFLLMRPSNTEQKLTIVIEA
TSEEELCKLLDFTIAVLEDHEERLKDRAIDLKDLEPTKSKFGPH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaggtattgccaccccaaaacataggtagcgtattaattgcccatgatgcacgtgag
gggggaccagagctagccaaagccctctataacgcacttaaaacccgggttaaaagtgag
cacatacagtttgctgggttggaacatcctgggcttttagctattcataatatccataaa
aattacgggcttattatttatataacagccagccacaaccctgttgggtttaatggattc
aaaatttattgcgattcgttacccatagattctgagactataaagcttatagcttacaac
atgaagcgactcgcagatgctgacttcaaattcctgcattatagtgaggaaatttttgag
cagcctcctatcgaagaaatcgaaaatagcgagtatataaacgctttgcttagcgagccc
gattattgtcatgaaaagtacatattaaaaattgctattgatggtggcaatggcgttgcg
ggtctcattgcccgtgagttatacgaaaaaatggggcatgaggttttagaacttaactgc
ataccagacggtgcgtttccaaatcatcatcccgacccctctgttcccgataatttaatg
cagttgcgtaagtttgtagttgaacatggatgcgatatcgggctggcatttgacggagat
gctgatagattgggagttgtggactatcaaggtcagattatagggtctgatagggtgttt
atttttttaattcgagagatgatgaaattttataagtcttactctgattatgaccctgcg
aaacccgtacatatagtgtatgacataaaatcaagtcggcatatacaaagagagattgag
gcggcgggggcattgccacatttatctaaaacagggcattcaaatatgatgcagaaagtt
gcacaaattgagggtgctctttttggaggagaatatagtggtcattactacttcaagaag
gatggacttattttaaatgatgcggtctattctggatttagaattttaagatttatagaa
gaagttggaccagaggcttttgaacatctaccacatgatttaatggtacctgaaattaga
attccgtatccaagggagctagtcaaaggactacttttgcatgtaaaagattctgctcaa
aagaatctaaaccccatctcttttactgaaatagacgggttacgtatcgagatagaaggc
ggatttttgcttatgcgaccatctaatacggagcagaaattaacaattgttatcgaggca
acttccgaagaagagctttgtaaactactagattttacgattgccgtactagaggatcat
gaggaacgacttaaggaccgagccatagatttaaaagaccttgagcccaccaaaagtaaa
ttcggtcctcattaa

DBGET integrated database retrieval system