KEGG   Taylorella equigenitalis MCE9: TEQUI_0943Help
Entry
TEQUI_0943        CDS       T01390                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_0943
   00030 Pentose phosphate pathway
    TEQUI_0943
   00051 Fructose and mannose metabolism
    TEQUI_0943
   00052 Galactose metabolism
    TEQUI_0943
   00500 Starch and sucrose metabolism
    TEQUI_0943
   00520 Amino sugar and nucleotide sugar metabolism
    TEQUI_0943
  Nucleotide metabolism
   00230 Purine metabolism
    TEQUI_0943
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TEQUI_0943
Enzymes [BR:teq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TEQUI_0943
    5.4.2.8  phosphomannomutase
     TEQUI_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967574..968968)
Genome map
AA seq 464 aa AA seqDB search
MEVLPPQNIGSVLIAHDAREGGPELAKALYNALKTRVKSEHIQFAGLEHPGLLAIHNIHK
NYGLIIYITASHNPVGFNGFKIYCDSLPIDSETIKLIAYNMKRLADADFKFLHYSEEIFE
QPPIEEIENSEYINALLSEPDYCHEKYILKIAIDGGNGVAGLIARELYEKMGHEVLELNC
IPDGAFPNHHPDPSVPDNLMQLRKFVVEHGCDIGLAFDGDADRLGVVDYQGQIIGSDRVF
IFLIREMMKFYKSYSDYDPAKPVHIVYDIKSSRHIQREIEAAGALPHLSKTGHSNMMQKV
AQIEGALFGGEYSGHYYFKKDGLILNDAVYSGFRILRFIEEVGPEAFEHLPHDLMVPEIR
IPYPRELVKGLLLHVKDSAQKNLNPISFTEIDGLRIEIEGGFLLMRPSNTEQKLTIVIEA
TSEEELCKLLDFTIAVLEDHEERLKDRAIDLKDLEPTKSKFGPH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggaggtattgccaccccaaaacataggtagcgtattaattgcccatgatgcacgtgag
gggggaccagagctagccaaagccctctataacgcacttaaaacccgggttaaaagtgag
cacatacagtttgctgggttggaacatcctgggcttttagctattcataatatccataaa
aattacgggcttattatttatataacagccagccacaaccctgttgggtttaatggattc
aaaatttattgcgattcgttacccatagattctgagactataaagcttatagcttacaac
atgaagcgactcgcagatgctgacttcaaattcctgcattatagtgaggaaatttttgag
cagcctcctatcgaagaaatcgaaaatagcgagtatataaacgctttgcttagcgagccc
gattattgtcatgaaaagtacatattaaaaattgctattgatggtggcaatggcgttgcg
ggtctcattgcccgtgagttatacgaaaaaatggggcatgaggttttagaacttaactgc
ataccagacggtgcgtttccaaatcatcatcccgacccctctgttcccgataatttaatg
cagttgcgtaagtttgtagttgaacatggatgcgatatcgggctggcatttgacggagat
gctgatagattgggagttgtggactatcaaggtcagattatagggtctgatagggtgttt
atttttttaattcgagagatgatgaaattttataagtcttactctgattatgaccctgcg
aaacccgtacatatagtgtatgacataaaatcaagtcggcatatacaaagagagattgag
gcggcgggggcattgccacatttatctaaaacagggcattcaaatatgatgcagaaagtt
gcacaaattgagggtgctctttttggaggagaatatagtggtcattactacttcaagaag
gatggacttattttaaatgatgcggtctattctggatttagaattttaagatttatagaa
gaagttggaccagaggcttttgaacatctaccacatgatttaatggtacctgaaattaga
attccgtatccaagggagctagtcaaaggactacttttgcatgtaaaagattctgctcaa
aagaatctaaaccccatctcttttactgaaatagacgggttacgtatcgagatagaaggc
ggatttttgcttatgcgaccatctaatacggagcagaaattaacaattgttatcgaggca
acttccgaagaagagctttgtaaactactagattttacgattgccgtactagaggatcat
gaggaacgacttaaggaccgagccatagatttaaaagaccttgagcccaccaaaagtaaa
ttcggtcctcattaa

DBGET integrated database retrieval system