KEGG   Taylorella equigenitalis MCE9: TEQUI_0947Help
Entry
TEQUI_0947        CDS       T01390                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TEQUI_0947
Enzymes [BR:teq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TEQUI_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973052..973945
Genome map
AA seq 297 aa AA seqDB search
MKSLLVPAPAKLNLFLHLAGRRSDGYHNLESVFVLIDYCDYLQFETTDDHQIKVLPQIEG
VPTEDNLIFKAASTLQKLANERSIATPGVRINLTKNIPMGGGLGGGSSDCASTLMALNYL
WDLNLSEEQLRIIGLKLGADVPFFIGGNTSFIQGIGEELHDFDVDGLWFLVIEPDFSIPT
VEIFTHPDLNRNYRSLSSKELEDAKVALSKAYFWGSNYLESAAFKIYPQLQNIVDSAYPI
KLRMSGSGSCLFAMFLSEAEAIKSLSDLNALIHKLSLPIRKLSVYKQLSKHPIKDVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtcttctagttcctgctcctgcaaaattgaatctttttttgcaccttgcgggt
cgtaggtctgatggctaccataatcttgaatctgtttttgtactgattgattattgtgat
tacttgcaatttgaaactacagacgaccaccaaatcaaagtactaccgcagatagaggga
gtacctacagaagataatctaatttttaaagcagcttcaacacttcaaaaattggcgaat
gaaagaagtattgccacccctggagtacggattaatcttacaaaaaatattcctatgggc
ggaggactcggaggcggttcgagcgactgtgcaagtacattaatggcgctgaattatctg
tgggatttaaatctgtcagaagaacagttgcggattattggtctgaaacttggggcggac
gtaccattttttatcggtggcaatacctcctttatccaaggtataggcgaagagcttcac
gattttgatgtagacggcttatggtttttggttatagaaccagatttcagtataccgact
gttgaaatttttacgcatccagacttaaatcgaaattaccgtagcctaagtagtaaagaa
ttagaagatgcgaaagtggctttaagtaaggcatatttttgggggagtaattatttagaa
tctgcagcatttaaaatttaccctcaacttcaaaatattgtagattctgcttatcctata
aagcttagaatgagtgggtcaggatcctgtttgttcgcaatgtttctgtcagaagccgaa
gcaataaaatccctatcggatttaaatgccctaatccataagttgtctctcccaattcgt
aaactatcggtttataagcaactaagtaagcacccaattaaagatgtgttgtaa

DBGET integrated database retrieval system