KEGG   Taylorella equigenitalis MCE9: TEQUI_1037Help
Entry
TEQUI_1037        CDS       T01390                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEQUI_1037
   01230 Biosynthesis of amino acids
    TEQUI_1037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_1037
   00051 Fructose and mannose metabolism
    TEQUI_1037
   00562 Inositol phosphate metabolism
    TEQUI_1037
Enzymes [BR:teq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TEQUI_1037
Exosome [BR:teq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TEQUI_1037
  Exosomal proteins of bladder cancer cells
   TEQUI_1037
  Exosomal proteins of melanoma cells
   TEQUI_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091748..1092533
Genome map
AA seq 261 aa AA seqDB search
MDALTIPLIVGNWKMNGSIQANHTLLSALLDGIALWSLPIKQEVVVCPPFPYLHQVRDIL
AMDGADSFDPISLGAQDLSFNQNGAHTGDVSAEMLRDFGCDWVIVGHSERKATHSESTAV
VGLKAKMAVDFGITPIVCLGESLELREAGQALHAIDVQLQPILEFGPDLIKSCVFAYEPV
WAIGSGIIANSEQIFEMHSHIRKQIQSVVGQEGNPIRIIYGGSVKPEQAKELFSLDCVDG
ALVGGASLNPDEFLSIIEASS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcattaaccatacctcttatagttggaaattggaagatgaatggcagtatacaa
gccaatcatacccttttgtcagcactactagacggtattgctttgtggtcactgcctata
aagcaagaggtggttgtttgccctccattcccttatcttcatcaagttcgcgatatttta
gcgatggatggtgctgattcatttgatccgatttctttaggggctcaggatttaagtttt
aatcaaaatggcgctcacacgggtgatgtttcggctgagatgcttagagattttggatgt
gattgggttattgtaggtcactccgagcgtaaggctactcattctgaaagtactgctgtt
gtaggcctaaaggctaagatggcagttgattttggtattacgcctatcgtctgtttgggt
gagagccttgagcttcgagaagctgggcaggctttgcatgctattgatgttcaacttcag
cctatacttgaatttggacctgatcttattaagtcttgtgtctttgcttacgagccagtt
tgggctattggctcaggaatcattgcgaatagtgagcaaatttttgagatgcactcacat
attcgaaagcaaattcagtcggtagtaggtcaagagggtaatccaatacgcattatttat
ggaggcagtgttaagcccgaacaggctaaagaattatttagtttagattgtgttgacggt
gcccttgtaggtggtgcttctttgaacccagacgagttcttgagcattattgaggcatct
tcttaa

DBGET integrated database retrieval system