KEGG   Taylorella equigenitalis MCE9: TEQUI_1037Help
Entry
TEQUI_1037        CDS       T01390                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEQUI_1037
   01230 Biosynthesis of amino acids
    TEQUI_1037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TEQUI_1037
   00051 Fructose and mannose metabolism
    TEQUI_1037
   00562 Inositol phosphate metabolism
    TEQUI_1037
Enzymes [BR:teq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TEQUI_1037
Exosome [BR:teq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TEQUI_1037
  Exosomal proteins of bladder cancer cells
   TEQUI_1037
  Exosomal proteins of melanoma cells
   TEQUI_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091748..1092533
Genome map
AA seq 261 aa AA seqDB search
MDALTIPLIVGNWKMNGSIQANHTLLSALLDGIALWSLPIKQEVVVCPPFPYLHQVRDIL
AMDGADSFDPISLGAQDLSFNQNGAHTGDVSAEMLRDFGCDWVIVGHSERKATHSESTAV
VGLKAKMAVDFGITPIVCLGESLELREAGQALHAIDVQLQPILEFGPDLIKSCVFAYEPV
WAIGSGIIANSEQIFEMHSHIRKQIQSVVGQEGNPIRIIYGGSVKPEQAKELFSLDCVDG
ALVGGASLNPDEFLSIIEASS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcattaaccatacctcttatagttggaaattggaagatgaatggcagtatacaa
gccaatcatacccttttgtcagcactactagacggtattgctttgtggtcactgcctata
aagcaagaggtggttgtttgccctccattcccttatcttcatcaagttcgcgatatttta
gcgatggatggtgctgattcatttgatccgatttctttaggggctcaggatttaagtttt
aatcaaaatggcgctcacacgggtgatgtttcggctgagatgcttagagattttggatgt
gattgggttattgtaggtcactccgagcgtaaggctactcattctgaaagtactgctgtt
gtaggcctaaaggctaagatggcagttgattttggtattacgcctatcgtctgtttgggt
gagagccttgagcttcgagaagctgggcaggctttgcatgctattgatgttcaacttcag
cctatacttgaatttggacctgatcttattaagtcttgtgtctttgcttacgagccagtt
tgggctattggctcaggaatcattgcgaatagtgagcaaatttttgagatgcactcacat
attcgaaagcaaattcagtcggtagtaggtcaagagggtaatccaatacgcattatttat
ggaggcagtgttaagcccgaacaggctaaagaattatttagtttagattgtgttgacggt
gcccttgtaggtggtgcttctttgaacccagacgagttcttgagcattattgaggcatct
tcttaa

DBGET integrated database retrieval system