KEGG   Taylorella equigenitalis MCE9: TEQUI_1090Help
Entry
TEQUI_1090        CDS       T01390                                 

Definition
ribosomal large subunit pseudouridine synthase C (EC:4.2.1.70)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
teq  Taylorella equigenitalis MCE9
Brite
Enzymes [BR:teq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     TEQUI_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1150922..1151854
Genome map
AA seq 310 aa AA seqDB search
MTISLPSVKYVQVDDSSDGQRIDNFLIKFSKGVPKSHIYKAIRSGQVRVNKGRVNSECRI
HTGDEIRIPPFRLPQEQPKSFIPTRNFDIIFEDDYFLIINKPAGVAVHGGSGVSYGVIEQ
IRTSRPDSKFLELVHRLDKETSGLLIIAKKRSALVALQDMIRQSKLHKSYYALIKGNWPE
KLKDIKLPLYKYLTPQGERRVKVDAENGKYAHSKVRKVEKVGEFELLSVQILTGRTHQIR
VHLRSSGFPIVGDEKYGDDALTLHVKKLGFNRMFLHAYILSFVHPITEKRLEFKIDLPDD
CKSLLKKLNI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttccctaccttcagttaaatatgtccaagtggatgattcatctgatggtcaa
cgtatagacaactttcttattaagttttcaaaaggagtgcccaaaagccatatttataaa
gctatccgctctggtcaggttagagttaataaaggcagagttaattctgaatgccgaatt
catacaggggatgaaataagaattcctccctttcgattacctcaggagcaacctaaaagt
ttcatacctactagaaactttgatattatttttgaggatgactacttcttaatcataaat
aagcctgctggtgttgctgttcatggtggaagcggagtctcttatggggtaatcgaacag
ataaggactagcagaccagatagtaaatttctagaattagtacatagactggataaggaa
acgtccggtctcttaatcattgccaaaaaaagaagtgctttagttgctcttcaggatatg
attaggcagtccaaattacataaaagctattatgcacttataaaaggaaattggcctgaa
aaattaaaggatataaagttgccactatataagtatctaaccccacaaggagagagaagg
gtaaaggttgatgccgaaaatggaaaatatgcacattctaaagtaagaaaagtagaaaaa
gtaggagaatttgaacttttaagtgtgcagatattgacaggtcggacgcatcaaattcgt
gtacatttaagatcaagtggatttccgattgtgggagatgaaaaatatggggacgacgca
ttgacactacatgttaaaaaacttggttttaataggatgtttttacatgcgtatatatta
tcctttgttcatcctattactgagaagagactagaatttaaaatcgaccttccagacgat
tgcaaatcacttttaaaaaaacttaatatatga

DBGET integrated database retrieval system