KEGG   Taylorella equigenitalis MCE9: TEQUI_1310Help
Entry
TEQUI_1310        CDS       T01390                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEQUI_1310
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TEQUI_1310
  Amino acid metabolism
   00310 Lysine degradation
    TEQUI_1310
Enzymes [BR:teq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TEQUI_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378735..1379979
Genome map
AA seq 414 aa AA seqDB search
MSIVNVVVPQLSESVSEGTLIEWKFKVGDQVSVDEILVEIETDKVLLEVPSPSAGVITEI
LEQDGATVTPDQVLAKIDTEAKAEAKAEDTSKQSEPKEDAQSSKETTVESAKSDNSLAQK
SGSKGDVASPAARNILAEKDMKASDVAGSGRDGRVTKADAQKASKGSSVSKPSAPMATNT
EGRIEERIPMTRLRARVAERLIQSQQQNAILTTFNEVNMKPVMDLRNKYKESFEKEHGIK
LGFMSFFVKAAVHGLKKYPILNASVDGNDIVYHGYFDIGVAVSSPRGLVVPVIRNADQLS
FADIEKTIAEFGQKAKEGKLGLDELTGGTFTVSNGGVFGSMMSTPIINPPQSAILGIHAT
RERAVVENGEIVIRPMNYFALSYDHRIIDGREAVLGLVAMKEALEDPQRLLLNL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgttaatgttgtagtacctcagctttctgagtcagtgtcagagggcactctt
attgaatggaaatttaaagtaggtgatcaagtttctgttgatgaaattttggttgagatt
gaaactgataaagttcttcttgaagttccatctccatctgcaggtgtaattactgagatt
ttagagcaagacggtgcaaccgtaactcctgatcaagttttagcgaaaattgatactgaa
gctaaagctgaggctaaagctgaggatacatcaaaacaatcagaacctaaggaagatgct
caatcttctaaagaaactactgtagaatctgctaaatcagataattcattagctcaaaaa
tctggttcaaaaggtgatgtagcttctccagctgctcgtaatattcttgctgaaaaagat
atgaaagcctctgatgttgccggttcaggtcgcgatggtcgcgtaactaaagctgatgct
caaaaagcatctaaaggctcttctgtttctaaaccatctgcacctatggctactaacact
gaaggtcgtatcgaagaacgtattcctatgactcgtttacgtgctcgtgtcgcagaaaga
ttaattcaatcacaacaacaaaacgcaatacttactacatttaacgaagtgaacatgaaa
cctgttatggaccttcgtaataagtacaaggaatcattcgaaaaagaacatggaattaaa
ttaggctttatgtctttctttgtgaaagctgctgttcatggacttaaaaaatatccaatt
cttaatgcttctgttgatggcaatgatatcgtttaccacggttattttgatattggtgtt
gcggtttcaagcccacgtggtctagtagttcctgtaatccgtaatgctgatcaactaagc
tttgctgatattgaaaaaacaattgctgaatttggtcaaaaagctaaagagggtaaatta
ggtttggacgaattaacaggtggtacattcacagtttctaacggtggtgtattcggttct
atgatgtctactccaatcatcaatcctccacaatcagcaatactaggtatccatgcaact
cgcgaacgtgcagtagttgaaaacggtgaaatcgttattcgtcctatgaactactttgca
ctttcttatgatcatagaattatcgacggacgtgaggctgtacttggattagttgctatg
aaagaagcacttgaagatccacaacgtcttcttttaaatctgtaa

DBGET integrated database retrieval system