KEGG   Taylorella equigenitalis MCE9: TEQUI_1323Help
Entry
TEQUI_1323        CDS       T01390                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TEQUI_1323
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TEQUI_1323
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TEQUI_1323
Enzymes [BR:teq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TEQUI_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393783..1395273
Genome map
AA seq 496 aa AA seqDB search
MKYVSTRGGVEPAEFCDILIEGLAADGGLYVPESIPYIDIEVLEGWRNLTYKQVALQVLS
LLITDIPYNDLKNIIDKTYTLDNFESSEIVPLKKFKFGHAKEFYLLGLSEGPTLAFKDLP
LQFLGNLYEYVLNKKQTYVNVLGSTSGDTGSAAEYALKGKKGVNVFMLSPHGRMSDFQKA
QMYTLDNPNIHNLAVKGVFDECQDIVKAINGDLEFKRKHHIAAVNSINFARIAAQVVYYF
WAWLQVSKPVESKYRDSKINDNLKHKNIATYKAEVIDVTVPTGNFGNILAALIASMMGCP
LGDLIVATNENNVLEEFFKTGVYKPRIPAETIATSSPSMDISKASNFERFVYFLYDCDAS
KVKDLWSRLAEDGSFDLSERLSEIEGTDHFFTFKAGRSTHEDRIKTIKDFYDKTEYILDP
HTADGVKVSSEFQSENKIMVVAETALSTKFAITVKESLGFEPKVPERFNEMLNKPRHEVV
TENSVEEVKDYIQKHS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtatcaaccagaggtggagtcgaaccagctgaattttgcgatattttaatt
gaaggtttggctgcagatggtggattatatgtgccagagtctattccatatatagatata
gaagtgcttgaaggttggagaaatcttacatataagcaagtagctctacaggttttaagt
ttattaataactgatattccatataacgaccttaaaaacattatcgataaaacatacaca
ttagataattttgaaagtagtgaaatagttcctcttaaaaaatttaaattcggacatgca
aaagaattttatctattaggattgtcagaggggccgactttagctttcaaggatcttcct
ttgcagtttttgggaaacctttatgaatatgtcctaaataagaagcaaacatatgtaaat
gttttgggatctacatcaggagatactgggtctgcagctgaatatgcattaaaaggaaaa
aaaggcgtaaatgtctttatgctctcaccgcatggtcgtatgagtgattttcagaaagcc
cagatgtacactttagataatccaaacattcacaatttagcagtcaaaggtgtatttgat
gaatgtcaggatatagtaaaggctattaatggcgatttagagtttaagagaaagcatcat
atagcggcagtgaattcaattaattttgcacgcattgcagcacaagttgtgtactacttt
tgggcttggttacaggttagtaagccagttgagtcaaaatatagagatagcaaaattaat
gataatttgaagcacaaaaacattgccacttacaaagctgaagttatagacgtaaccgta
cctacaggtaattttggcaatattctggcagccttaattgcatctatgatgggatgtcct
ttgggtgatttgattgtagctacaaatgaaaataacgtacttgaagaattttttaaaact
ggtgtctataaaccacgtattcctgctgaaaccattgccacatcaagtccatctatggat
atttctaaggcctcaaattttgagcgtttcgtatatttcttatatgattgtgatgcctct
aaggttaaagatctttggagccgtttagctgaagatggaagttttgatctttctgagaga
ctaagtgaaattgagggaactgatcacttctttacttttaaagcgggtcgtagtactcat
gaagatcgaattaaaacaatcaaagatttctacgataaaaccgaatatatcctagatcca
catactgctgacggtgtaaaagtttcatctgaatttcaatcagaaaataagattatggta
gtcgcagaaacagctctatctactaagtttgctattacagttaaagaatctttaggattt
gagcctaaagttcctgagcgatttaatgaaatgctcaataaacctcgtcatgaagtagtt
acggaaaactcagtggaagaggtgaaggactatatccaaaagcattcataa

DBGET integrated database retrieval system