KEGG   Taylorella equigenitalis MCE9: TEQUI_1323Help
Entry
TEQUI_1323        CDS       T01390                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TEQUI_1323
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TEQUI_1323
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TEQUI_1323
Enzymes [BR:teq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TEQUI_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393783..1395273
Genome map
AA seq 496 aa AA seqDB search
MKYVSTRGGVEPAEFCDILIEGLAADGGLYVPESIPYIDIEVLEGWRNLTYKQVALQVLS
LLITDIPYNDLKNIIDKTYTLDNFESSEIVPLKKFKFGHAKEFYLLGLSEGPTLAFKDLP
LQFLGNLYEYVLNKKQTYVNVLGSTSGDTGSAAEYALKGKKGVNVFMLSPHGRMSDFQKA
QMYTLDNPNIHNLAVKGVFDECQDIVKAINGDLEFKRKHHIAAVNSINFARIAAQVVYYF
WAWLQVSKPVESKYRDSKINDNLKHKNIATYKAEVIDVTVPTGNFGNILAALIASMMGCP
LGDLIVATNENNVLEEFFKTGVYKPRIPAETIATSSPSMDISKASNFERFVYFLYDCDAS
KVKDLWSRLAEDGSFDLSERLSEIEGTDHFFTFKAGRSTHEDRIKTIKDFYDKTEYILDP
HTADGVKVSSEFQSENKIMVVAETALSTKFAITVKESLGFEPKVPERFNEMLNKPRHEVV
TENSVEEVKDYIQKHS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtatcaaccagaggtggagtcgaaccagctgaattttgcgatattttaatt
gaaggtttggctgcagatggtggattatatgtgccagagtctattccatatatagatata
gaagtgcttgaaggttggagaaatcttacatataagcaagtagctctacaggttttaagt
ttattaataactgatattccatataacgaccttaaaaacattatcgataaaacatacaca
ttagataattttgaaagtagtgaaatagttcctcttaaaaaatttaaattcggacatgca
aaagaattttatctattaggattgtcagaggggccgactttagctttcaaggatcttcct
ttgcagtttttgggaaacctttatgaatatgtcctaaataagaagcaaacatatgtaaat
gttttgggatctacatcaggagatactgggtctgcagctgaatatgcattaaaaggaaaa
aaaggcgtaaatgtctttatgctctcaccgcatggtcgtatgagtgattttcagaaagcc
cagatgtacactttagataatccaaacattcacaatttagcagtcaaaggtgtatttgat
gaatgtcaggatatagtaaaggctattaatggcgatttagagtttaagagaaagcatcat
atagcggcagtgaattcaattaattttgcacgcattgcagcacaagttgtgtactacttt
tgggcttggttacaggttagtaagccagttgagtcaaaatatagagatagcaaaattaat
gataatttgaagcacaaaaacattgccacttacaaagctgaagttatagacgtaaccgta
cctacaggtaattttggcaatattctggcagccttaattgcatctatgatgggatgtcct
ttgggtgatttgattgtagctacaaatgaaaataacgtacttgaagaattttttaaaact
ggtgtctataaaccacgtattcctgctgaaaccattgccacatcaagtccatctatggat
atttctaaggcctcaaattttgagcgtttcgtatatttcttatatgattgtgatgcctct
aaggttaaagatctttggagccgtttagctgaagatggaagttttgatctttctgagaga
ctaagtgaaattgagggaactgatcacttctttacttttaaagcgggtcgtagtactcat
gaagatcgaattaaaacaatcaaagatttctacgataaaaccgaatatatcctagatcca
catactgctgacggtgtaaaagtttcatctgaatttcaatcagaaaataagattatggta
gtcgcagaaacagctctatctactaagtttgctattacagttaaagaatctttaggattt
gagcctaaagttcctgagcgatttaatgaaatgctcaataaacctcgtcatgaagtagtt
acggaaaactcagtggaagaggtgaaggactatatccaaaagcattcataa

DBGET integrated database retrieval system