KEGG   Taylorella equigenitalis MCE9: TEQUI_1388Help
Entry
TEQUI_1388        CDS       T01390                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:teq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:teq00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:teq00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:teq00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467922..1469367
Genome map
AA seq 481 aa AA seqDB search
MSQLIEVKVPDIGDFDDVSVIEVLVKEGDKISVDQSIITVESDKASMEIPSSASGIIKKL
SVKLGDKVKEGVVLLTVESTDGDSKGQSSEISQIDDSKAADNSVNEKNVSKEQGAGGDSG
IYDIKASQLTQEKQNTVEDNASSMTFVAQSSDAGDKVGKSKESPTAAYALTANEIRNLPH
ASPSVRQFARSLGVDLNQVKGTGRKNRIVLDDVRSFVKSALSAPGGVTTGSSTLGGSGLS
VLDWPKVDFSKFGEIDSKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLEAFRVQLN
KEHEKAGIKFTMLAFIFKAVVQALKKYPEFNSSIDGENIVYKKYFHLGFAADTPNGLVVP
VIRDADKKSISDIAKETSELAKLARDGKLSPSQMQGGCFTISSLGGIGGTHFTPIINAPE
VAILGVSRSYQKPVWNGKEFQPRLTLPLSLSYDHRIIDGAAAARFNVCLCQILSDFRRAM
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattaattgaagtaaaagttcctgatataggcgattttgatgatgtatctgtt
attgaagtgcttgttaaagagggggataaaatttctgtagaccaaagtattataactgtt
gagtccgataaagcctctatggagattccaagtagtgcttctggaatcattaaaaaacta
tcagttaaattgggagacaaagttaaagaaggagtggtgctgttaactgttgaatcaact
gatggcgactctaagggtcaatcttctgaaatttcacaaattgatgattctaaagcggct
gataattctgttaatgagaaaaatgtttccaaagagcagggagctggaggggattcagga
atttatgatattaaagcatctcaattaacacaagaaaaacaaaatacagttgaagataat
gcgtcttctatgacatttgttgctcaatcttctgatgctggagataaggttggcaaaagt
aaagaatcacctactgctgcttatgctttaactgcaaacgaaatacgtaatcttccacat
gcatctccatctgtaaggcaatttgctcgttccttaggtgtagatttaaatcaagtaaaa
ggcacaggtcgtaaaaatagaattgtgcttgatgatgttaggtctttcgtaaaatccgcg
ctatcagcacctggcggagttacaactggatcttctactttaggcggttcaggattatca
gttcttgattggcctaaagttgatttttctaaatttggtgagatcgacagtaaaccgctt
tctcgtattaagaaaatttcgggagcaaaccttcatagaaattgggtaatgattccacac
gtaaccaataacgatgaagctgatattactgatttagaagctttcagagttcaacttaat
aaagaacatgagaaagctggtattaaatttacaatgcttgcttttatctttaaggctgtt
gttcaagctttgaaaaaatacccagagtttaattcatctattgatggtgaaaatattgtg
tataaaaaatattttcatcttgggtttgctgcagatacacctaatggattagtagtgcct
gtaataagagatgctgataaaaaatccatttcggatatagccaaagaaacctcagaactt
gctaaattagcacgtgatggaaaattgagcccatctcaaatgcaaggtggatgcttcaca
atatcatctttaggaggtattgggggtactcatttcacacctattattaatgcacctgaa
gtggctatattgggcgttagtcgctcataccagaaaccagtttggaatggcaaagaattc
cagcctcgtcttacattgccactatccttgtcatatgatcacaggattattgatggtgca
gctgcagctaggtttaatgtatgtctatgtcaaattttgtctgatttcagaagggctatg
atttaa

DBGET integrated database retrieval system