KEGG   Taylorella equigenitalis MCE9: TEQUI_1474Help
Entry
TEQUI_1474        CDS       T01390                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TEQUI_1474
  Amino acid metabolism
   00300 Lysine biosynthesis
    TEQUI_1474
Enzymes [BR:teq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TEQUI_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1560715..1561860
Genome map
AA seq 381 aa AA seqDB search
MNTQNITTLELLKDLISRESISPNDAGCQDVLADLLKKQGFKAEFMEFGAVKNLWIRHGD
LAPLVVFAGHTDVVPSGPRDLWDSPPFEPTIRNNKLYGRGAADMKAGVAASAIASYEFVK
AYPNHNGSVALLITSDEESIAIDGTVKVCEVLEKRGESIDYCVVAEPSCVDKLGDTIKIG
RRGSYGATLTIKGKQGHVAYPHKVKNPIHLAVPAVAELCSTVWDEGNKFFPPTSFQISNY
RAGTGAANVVPGIAHIEFNFRFCTESTPESLKNRVEEILNKHNLDYEIEWILGGEPFLTE
AEDLTKAMIDSIKEVTGVDAQLSTTGGTSDGRFIAKMNPKPKVLEFGVINASIHQINEHV
DVDDLEKSKDIYFKVLEKLLA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcaaaatataaccacacttgaactgcttaaagatttaatttcacgtgaatcc
atttcaccaaacgatgctggatgccaggatgtattagcagatcttcttaaaaaacaaggt
tttaaagcggaattcatggagtttggtgctgtaaaaaacctttggattcgtcatggagac
ctagcaccattagtagtatttgctggacacactgatgttgtaccctctggacctagggat
ttgtgggattctccacctttcgaacctactattcgaaacaataaactttatggacgtggg
gctgctgatatgaaagcaggagttgctgcaagtgccattgccagctatgaatttgttaaa
gcatatccaaatcataatggttcagttgctcttttgattacctctgatgaggaaagtatc
gctatcgatggcacggtaaaagtctgtgaagtccttgaaaaacgcggtgaatctattgac
tactgtgtcgtagccgaaccttcatgtgtagataaattgggagatactattaaaattggt
cgtcgtgggtcttacggggctactttgactattaaaggtaaacaaggacatgtagcttat
ccacataaagtcaaaaatcctattcatttagcggtacctgctgttgctgaattatgtagt
actgtttgggatgagggtaataaattctttccccctacttcatttcagatatccaattat
cgtgctggtactggtgcagcaaatgtagtccctggaattgctcacattgaatttaatttc
agattctgcactgaaagcactcctgaatcattaaaaaatcgtgttgaagaaatactaaat
aaacacaacctagactatgaaatcgaatggattctaggaggcgagccttttttaactgaa
gccgaagatttaacaaaagcgatgattgattccatcaaagaagtaactggtgttgatgct
caattgagcactactggtggtacatcagacggcaggtttatcgcaaaaatgaatcctaaa
ccaaaggttttggaatttggtgtaattaatgccagcattcaccaaataaacgagcatgtt
gatgtagatgacttagaaaaaagcaaagacatttactttaaagtattagaaaaactttta
gcttaa

DBGET integrated database retrieval system