KEGG   Taylorella equigenitalis MCE9: TEQUI_1542Help
Entry
TEQUI_1542        CDS       T01390                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TEQUI_1542
Enzymes [BR:teq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TEQUI_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1633225..1633995)
Genome map
AA seq 256 aa AA seqDB search
MLHLVLTSNSSRNRELSSLFGSFINANFHDLPALQIEKLPRPKLTFFKSQLPNLNYIFFV
SRNAVDIFFQDFEDLVALLPSNIKFLCVGLSTAEQIRHYCQSFEIIFPDGNAQDSQALLQ
KLSPLLAYKAKFLIVKGEGGRGEFQDFLVRTGHEVFEICVYKRLCHKYTDSFLHELNLKH
LDDDYVFVFTSTEGVKCLLPQIEKFLTKEILRKSLFLVIHDRLREIIEYPHCETIQLNKA
SFIEVIKHYFNKKYLL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacttggtattgacgagtaattctagccgaaatagggagctttctagccttttc
ggttcttttataaatgcaaattttcacgatttgcccgcccttcaaattgaaaagctccct
aggcccaaattaacattttttaaatcacagcttcctaatctaaactatattttttttgtt
agcagaaatgcggttgatattttcttccaagattttgaggatttagtggctttactgcca
tcaaacataaaatttttgtgtgtaggattaagcactgctgagcagattagacactattgt
cagagttttgaaataatttttcctgatggcaatgcccaagattcccaagcacttttgcag
aaactttcacctttgttagcatataaagctaaatttttaattgtaaaaggtgaagggggt
agaggagagtttcaagactttttagtaagaactggccacgaagtttttgaaatatgtgtt
tataaaaggctttgccacaaatacaccgattcatttttgcatgaattaaatttaaagcat
ttagatgatgattatgtttttgtgtttacaagcacagaaggggtaaagtgtttattacca
cagattgagaaatttctaacaaaagagattttgagaaaatctctattccttgtgattcat
gatcgtttaagggaaattattgagtatcctcattgtgaaacaattcaattaaataaagca
agttttatagaagttataaagcattattttaataagaaatatttgctatga

DBGET integrated database retrieval system