KEGG   Taylorella equigenitalis MCE9: TEQUI_1546Help
Entry
TEQUI_1546        CDS       T01390                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00020  Citrate cycle (TCA cycle)
teq00640  Propanoate metabolism
teq00660  C5-Branched dibasic acid metabolism
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01120  Microbial metabolism in diverse environments
teq01130  Biosynthesis of antibiotics
teq01200  Carbon metabolism
Module
teq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
teq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TEQUI_1546
   00640 Propanoate metabolism
    TEQUI_1546
   00660 C5-Branched dibasic acid metabolism
    TEQUI_1546
Enzymes [BR:teq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TEQUI_1546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADU92458
UniProt: E8UE89
Position
complement(1636652..1637812)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILKKFGVNVLRGIPAFSVEEAVKAAEELGGNVWVVKAQIHAGGRGKGGGV
KLAKSIDEVRDLASQMLGMQLVTHQTGPQGQKVNRLLIEEGADIQKEYYLGIVTDRGSQR
NCIMASSEGGVNIEEVAHETPEKIIKVFIDPGHDVSYEQGLELVRGIGMPSELHDQAIDL
IQKLYKAYWETDATLAEINPLIHTGDGKVIALDAKFNFDSNALSRHPEIVEYRDLDEEDP
AEIEASKYDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLRSDSVKAILVNIFGGIMRCDVIAEGVVAACKAVDLKVPLVVRMKGTNEEQGKKI
LAESGLPIISADTMAEAATKVVEAAK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcaaggcaaagaaattctgaaaaagttcggggtaaatgtgctt
cgcggcatcccagcattttcagtagaagaggcagttaaagctgctgaagaattaggtggt
aatgtttgggttgttaaagctcaaattcatgctggcggtcgcggaaaaggcggtggcgtc
aaactagccaagtctattgatgaagttcgcgatttggcttctcagatgcttggcatgcaa
ttagttactcatcaaactggcccgcaaggtcaaaaagttaatcgtcttcttattgaagaa
ggtgctgatattcaaaaagagtattaccttggtatcgttactgaccgtggatctcaaaga
aattgcatcatggcttcaagtgagggtggggttaatattgaggaagttgcccatgaaact
ccagaaaaaatcattaaagttttcatcgacccaggtcatgatgtttcatacgagcaaggt
ttagagcttgttcgtggtataggtatgccttcggagttacatgatcaagctatagattta
attcaaaaactttacaaagcttactgggagacagatgcaaccttagctgaaatcaatcca
ctaattcatacaggagacggtaaagttattgcccttgatgctaagtttaatttcgattca
aatgcactttctcgtcatcctgaaattgttgaatatagggatttagacgaagaggatcct
gctgaaatcgaagcaagtaaatatgatttagcttatattcagttagatggtaatattggt
tgtttagttaatggtgctggattagcaatggctactatggataccattaaacttttcggg
ggcgaaccagctaacttccttgatgtaggtggtggagcgactgcggaaaaagtgaccgaa
gcattcaaaattatgctaagaagtgacagcgttaaagcaattttagtaaatatctttggt
ggaattatgcgttgtgatgtaattgctgaaggtgtagttgctgcctgcaaagctgtagat
ttgaaagtgccattggttgttcgtatgaaaggtactaacgaagaacaaggtaaaaaaatc
cttgctgaatctggattaccaatcatcagtgccgacactatggctgaagctgctactaaa
gtagtcgaagctgctaaataa

DBGET integrated database retrieval system