KEGG   Taylorella equigenitalis MCE9: TEQUI_1588Help
Entry
TEQUI_1588        CDS       T01390                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
teq  Taylorella equigenitalis MCE9
Pathway
teq00020  Citrate cycle (TCA cycle)
teq00190  Oxidative phosphorylation
teq00650  Butanoate metabolism
teq01100  Metabolic pathways
teq01110  Biosynthesis of secondary metabolites
teq01120  Microbial metabolism in diverse environments
teq01130  Biosynthesis of antibiotics
teq01200  Carbon metabolism
Module
teq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
teq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
teq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TEQUI_1588
   00650 Butanoate metabolism
    TEQUI_1588
  Energy metabolism
   00190 Oxidative phosphorylation
    TEQUI_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADU92500
UniProt: E8UEK9
Position
complement(1678973..1679347)
Genome map
AA seq 124 aa AA seqDB search
MSELFGTKKRAVGAHYGTIGFIVQRLTATLLAIYSVFFLLTLLFTPVTYENWLHLFTFTV
LSIPAGQICVTLVFFTLAWHAWIGIRDVWMDYIDCWMLRLVLFIFTIFWLIAMSMYFCFV
IWSL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattgttcggtactaaaaagagggctgtcggtgctcactacggaactataggt
tttatagttcaaagattaacggcaactttgcttgctatatactctgtgttttttctactt
acccttttatttactcctgtaacctatgaaaattggttgcaccttttcactttcactgta
ttaagtatacctgctggccaaatctgtgtgaccttagtgttctttactttagcatggcat
gcatggattggtattcgcgatgtttggatggattatattgactgttggatgcttcgtttg
gtgttattcatctttacaattttttggctaatcgctatgtctatgtatttctgttttgta
atttggagtctttaa

DBGET integrated database retrieval system