KEGG   Taylorella equigenitalis MCE9: TEQUI_1588Help
Entry
TEQUI_1588        CDS       T01390                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
teq  Taylorella equigenitalis MCE9
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:teq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TEQUI_1588
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TEQUI_1588
   00650 Butanoate metabolism
    TEQUI_1588
  Energy metabolism
   00190 Oxidative phosphorylation
    TEQUI_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1678973..1679347)
Genome map
AA seq 124 aa AA seqDB search
MSELFGTKKRAVGAHYGTIGFIVQRLTATLLAIYSVFFLLTLLFTPVTYENWLHLFTFTV
LSIPAGQICVTLVFFTLAWHAWIGIRDVWMDYIDCWMLRLVLFIFTIFWLIAMSMYFCFV
IWSL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattgttcggtactaaaaagagggctgtcggtgctcactacggaactataggt
tttatagttcaaagattaacggcaactttgcttgctatatactctgtgttttttctactt
acccttttatttactcctgtaacctatgaaaattggttgcaccttttcactttcactgta
ttaagtatacctgctggccaaatctgtgtgaccttagtgttctttactttagcatggcat
gcatggattggtattcgcgatgtttggatggattatattgactgttggatgcttcgtttg
gtgttattcatctttacaattttttggctaatcgctatgtctatgtatttctgttttgta
atttggagtctttaa

DBGET integrated database retrieval system