KEGG   Trichodesmium erythraeum: Tery_0069Help
Entry
Tery_0069         CDS       T00387                                 

Definition
(GenBank) leucyl aminopeptidase. Metallo peptidase. MEROPS family M17 (EC:3.4.11.1)
  KO
K01255  
leucyl aminopeptidase [EC:3.4.11.1]
Organism
ter  Trichodesmium erythraeum
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tery_0069
Enzymes [BR:ter01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     Tery_0069
Peptidases [BR:ter01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   Tery_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_0069
CYORF: 
UniProt: 
Position
94683..96173
Genome map
AA seq 496 aa AA seqDB search
MEIKVGNIPQLKWAGDALAIGLFEDAIKLTEDAIELTEEMAELDEMLSGTLSELIKETEF
KGKANSSVSTRVGIKTSIRKIIVVGLGKLEKFKLDSLRQAAATCGRLAKKERCKTLGISL
PMCQDADSTAIAITEGIELALHQDNRFKSEPENLGPDLEKVELIGLAASDEAIAHARKIC
SGVIFARELVAAPANSCTPITMAETAQTLAKEFGLTLEILEKEDCEKLGMGAFLGVAQGS
DLPPKFIHVTYKPEVTPRRKLAIVGKGLTFDSGGLNLKVSGSGIEMMKIDMGGAGTTFGT
IKAIAQLKPDVEVHFISAVTENMVSGHAIHPGDFLTASNGKIIEVNNTDAEGRLTLADAL
VFAEKLGVDAIIDLATLTGACVVALGNDIAGLWSPNDNLAAEITAAAEKAGEKMWRMPLE
EKYFEGLKAMHADMKNTGPRPGGAITAALFLKQFVKNTPWAHLDIAGPVWVDTENGYNNQ
GATGYGVRTLVNWILS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaagtaggtaacatacctcagttgaaatgggccggagatgctctagctatt
ggtttatttgaagatgctataaaattaactgaagatgctatagaattaactgaggaaatg
gccgaattggacgaaatgctatctggtactttatctgaattaattaaagaaacagaattt
aaaggtaaagcgaatagcagtgtctcaactcgtgtcggtataaaaacctctattcggaaa
attattgtagttggcctaggtaaattagagaagttcaaattagattctctgcgccaagct
gcagctacctgtggacgcttggcaaaaaaggagagatgtaaaactttagggattagcctg
ccaatgtgtcaggatgctgattctacagctatagctattacagagggtattgagttagcc
ctccatcaagataatcgttttaaatctgaaccagaaaatctagggccagatctagaaaaa
gtggagttaattggtttggctgcttctgatgaagcgatcgcccatgctcgaaaaatctgt
tcaggagtcatctttgccagagaacttgtagcagctcctgctaattcctgtaccccaata
actatggctgaaactgctcagaccttagctaaagagtttggtctaactctagaaatttta
gaaaaagaagattgtgaaaaactaggaatgggagcttttcttggagttgctcaaggttct
gacttgccaccaaaattcattcatgtaacttataaaccagaagttactcctcgtcgcaag
ctagcaatagtaggaaaaggtttaacttttgactctggtgggttaaacttaaaagtctct
ggtagtggcattgaaatgatgaaaattgatatgggtggtgcaggtacaacttttggtact
attaaggcgatcgctcagttaaaaccagatgtagaagttcattttatcagtgctgtaact
gaaaatatggttagtggtcacgccatacatcccggtgactttctgactgcttccaatggt
aaaattattgaagttaataatacagatgcagagggacgtttgactttggcagatgcatta
gtctttgctgaaaagttgggagtagatgcaattatagatttagcgactctcacaggtgct
tgtgttgtggcattaggtaatgatattgctggtctgtggagccctaatgataatttagct
gcagaaataacagcagcagcagaaaaagctggagagaaaatgtggcggatgcctttggag
gagaaatatttcgagggtttgaaagctatgcatgctgatatgaagaataccggtcctcgc
cctggtggtgctattactgcagctttatttttgaagcaatttgttaaaaatacgccttgg
gcacatttagatattgccggtccggtttgggtagatacagaaaatggttacaataatcaa
ggtgcaactggttatggtgttcggactctagtgaattggattttgagttag

DBGET integrated database retrieval system